KEGG   Brachypodium distachyon: 100843035Help
Entry
100843035         CDS       T01717                                 

Definition
(RefSeq) triosephosphate isomerase, cytosolic
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00010  Glycolysis / Gluconeogenesis
bdi00051  Fructose and mannose metabolism
bdi00562  Inositol phosphate metabolism
bdi00710  Carbon fixation in photosynthetic organisms
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
bdi01200  Carbon metabolism
bdi01230  Biosynthesis of amino acids
Module
bdi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bdi_M00002  Glycolysis, core module involving three-carbon compounds
bdi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100843035
   00051 Fructose and mannose metabolism
    100843035
   00562 Inositol phosphate metabolism
    100843035
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100843035
Enzymes [BR:bdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100843035
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100843035
  Exosomal proteins of bladder cancer cells
   100843035
  Exosomal proteins of melanoma cells
   100843035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 100843035
NCBI-ProteinID: XP_014754140
Position
2
AA seq 271 aa AA seqDB search
MAPRKFFVGGNWKCNGAGDDVKKIVTVLNDAEAPRAPSVKVVVSPPFVFLQQVKGLLRPD
FAVAAQNCWVRKGDAFTGEISAEMLVNLQVPWVILGHSERRALLSDQMISLSGKFPRKIV
HNLTFVADKVAYALSQGLKVIACIGETLEQREAGTTMEVVAAQTKAIAEKVSDWTNVMLA
YESVWAIGTGKVASPAQAEEVHDGLRKWLNTNVTPAVAESIRIIYGGSVNGANCKELAAQ
PDLDGFLVGGASLKPEFVDIVKSATVKSSSA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaggaagttcttcgtcggcggcaactggaaatgcaacggggccggcgacgac
gtgaagaagatcgtcaccgtcctcaacgatgccgaggctccgagggcgccgtcggtgaag
gtggtggtgagcccgccgttcgtgttcctgcagcaggtgaaggggctgctgcggcccgac
ttcgctgtcgccgcgcagaactgctgggtgcgcaagggcgacgccttcaccggcgagatc
agtgctgagatgctggtgaacctgcaggtgccttgggtcattttggggcactctgagcgt
agagcgctgctcagtgatcaaatgatttccttgtcagggaaatttccacgaaaaattgtg
cacaaccttacttttgttgccgataaagttgcttacgcactcagccaaggactcaaggta
attgcttgcattggtgagacccttgaacagagagaagcaggaacaacaatggaagttgtt
gctgctcagactaaagctattgcagaaaaagtatcagactggacaaacgttatgctggca
tatgaatcagtttgggccattggaaccggcaaagttgcatctcctgctcaagcagaagag
gttcatgatggtctgagaaaatggctcaacactaatgttacccctgcagttgctgaatct
atcagaattatttatggaggctctgtaaatggcgcgaactgcaaagaacttgcggctcag
cctgatcttgatggattccttgttggaggagcttcactgaagccagagtttgtggacatc
gtcaagtctgccaccgtgaagtcttcttctgcttag

DBGET integrated database retrieval system