KEGG   Brachypodium distachyon: 100843035Help
Entry
100843035         CDS       T01717                                 

Definition
triosephosphate isomerase, cytosolic-like
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100843035
   01230 Biosynthesis of amino acids
    100843035
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100843035
   00051 Fructose and mannose metabolism
    100843035
   00562 Inositol phosphate metabolism
    100843035
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100843035
Enzymes [BR:bdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100843035
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100843035
  Exosomal proteins of bladder cancer cells
   100843035
  Exosomal proteins of melanoma cells
   100843035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 277 aa AA seqDB search
MAPRKFFVGGNWKCNGAGDDVKKIVTVLNDAEAPRAPSVKVVVSPPFVFLQQVKGLLRPD
FAVAAQNCWVRKGDAFTGEISAEMLVNLQVPWVILGHSERRALLSDQMMCFSFPCCKNLV
LGRFGVLVLAFVADKVAYALSQGLKVIACIGETLEQREAGTTMEVVAAQTKAIAEKVSDW
TNVMLAYESVWAIGTGKVASPAQAEEVHDGLRKWLNTNVTPAVAESIRIIYGGSVNGANC
KELAAQPDLDGFLVGGASLKPEFVDIVKSATVKSSSA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaggaagttcttcgtcggcggcaactggaaatgcaacggggccggcgacgac
gtgaagaagatcgtcaccgtcctcaacgatgccgaggctccgagggcgccgtcggtgaag
gtggtggtgagcccgccgttcgtgttcctgcagcaggtgaaggggctgctgcggcccgac
ttcgctgtcgccgcgcagaactgctgggtgcgcaagggcgacgccttcaccggcgagatc
agtgctgagatgctggtgaacctgcaggtgccttgggtcattttggggcactctgagcgt
agagcgctgctcagtgatcaaatgatgtgtttttcattcccatgttgtaagaacctggtg
ttaggtaggtttggtgtattagttttggcatttgttgccgataaagttgcttacgcactc
agccaaggactcaaggtaattgcttgcattggtgagacccttgaacagagagaagcagga
acaacaatggaagttgttgctgctcagactaaagctattgcagaaaaagtatcagactgg
acaaacgttatgctggcatatgaatcagtttgggccattggaaccggcaaagttgcatct
cctgctcaagcagaagaggttcatgatggtctgagaaaatggctcaacactaatgttacc
cctgcagttgctgaatctatcagaattatttatggaggctctgtaaatggcgcgaactgc
aaagaacttgcggctcagcctgatcttgatggattccttgttggaggagcttcactgaag
ccagagtttgtggacatcgtcaagtctgccaccgtgaagtcttcttctgcttag

DBGET integrated database retrieval system