KEGG   Brachypodium distachyon: 100843035Help
Entry
100843035         CDS       T01717                                 

Definition
triosephosphate isomerase, cytosolic-like
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bdi  Brachypodium distachyon
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:bdi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bdi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bdi00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bdi00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bdi00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:bdi00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 257 aa AA seqDB search
MAPRKFFVGGNWKCNGAGDDVKKIVTVLNDAEAPRAPSVKVVVSPPFVFLQQVKGLLRPD
FAVAAQNCWVRKGDAFTGEISAEMLVNLQVPWVILGHSERRALLSDQMMXFVADKVAYAL
SQGLKVIACIGETLEQREAGTTMEVVAAQTKAIAEKVSDWTNVMLAYESVWAIGTGKVAS
PAQAEEVHDGLRKWLNTNVTPAVAESIRIIYGGSVNGANCKELAAQPDLDGFLVGGASLK
PEFVDIVKSATVKSSSA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaggaagttcttcgtcggcggcaactggaaatgcaacggggccggcgacgac
gtgaagaagatcgtcaccgtcctcaacgatgccgaggctccgagggcgccgtcggtgaag
gtggtggtgagcccgccgttcgtgttcctgcagcaggtgaaggggctgctgcggcccgac
ttcgctgtcgccgcgcagaactgctgggtgcgcaagggcgacgccttcaccggcgagatc
agtgctgagatgctggtgaacctgcaggtgccttgggtcattttggggcactctgagcgt
agagcgctgctcagtgatcaaatgatgtgatttgttgccgataaagttgcttacgcactc
agccaaggactcaaggtaattgcttgcattggtgagacccttgaacagagagaagcagga
acaacaatggaagttgttgctgctcagactaaagctattgcagaaaaagtatcagactgg
acaaacgttatgctggcatatgaatcagtttgggccattggaaccggcaaagttgcatct
cctgctcaagcagaagaggttcatgatggtctgagaaaatggctcaacactaatgttacc
cctgcagttgctgaatctatcagaattatttatggaggctctgtaaatggcgcgaactgc
aaagaacttgcggctcagcctgatcttgatggattccttgttggaggagcttcactgaag
ccagagtttgtggacatcgtcaagtctgccaccgtgaagtcttcttctgcttag

DBGET integrated database retrieval system