KEGG   Brachypodium distachyon: 100843567Help
Entry
100843567         CDS       T01717                                 

Definition
mitogen-activated protein kinase kinase 4-like
Orthology
K13413  
mitogen-activated protein kinase kinase 4/5, plant [EC:2.7.12.2]
Organism
bdi  Brachypodium distachyon
Pathway
Plant-pathogen interaction
Class
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:bdi04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 357 aa AA seqDB search
MRPGGPPNARPQQPGTPGRARRRPDLTLPLPQRDLTSLAVPLPLPPPPSSAPSSASSSGS
SLSSMGAPTPPNSAGSAPPPPPPLAELERVRRIGSGAGGTVWMVRHRPTGRPYALKVLYG
NHDDAVRRQITREIAILRTAEHPAIVRCHGMYEQAGELQILLEFMDGGSLEGRRIASEAF
LADVARQVLSGIAYLHRRHIVHRDIKPSNLLIDSGRRVKIADFGVGRILNQTMDPCNSSV
GTIAYMSPERINTDLNDGAYDGYAGDIWSFGLSILEFYLGRFPLGENLGKQGDWAALMCA
ICYSDSPAPPPIASPEFKSFISCCLQKNPARRPSAAQLLQHRFIAGPQPQVLAAPPS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccgggcgggccgccgaacgcgcggccgcagcagccgggcaccccggggcgggcg
cggcgccgcccggatctcacgctgccgctgccgcagcgggacctcacatcgctcgccgtg
ccgctgcctctgcctcccccgccgtcctccgcgccgtcctctgcctcctcctcaggttcg
tccctatcgtccatgggcgcgccgaccccgcccaactcggcaggctccgcgccgccgccc
ccgccgccgctcgcggagctggagcgcgtccgccgcatcgggagcggggcaggcggcacg
gtctggatggtgcgccaccggcccacggggaggccctacgcgctcaaggtgctctacggg
aaccacgacgacgccgtgcggcggcagatcacgcgcgagatcgccatcctgcgcaccgcc
gagcacccggccatcgtgcgctgccacggcatgtacgagcaggccggggagctgcagatc
ctgctcgagttcatggacgggggctccctcgagggccgccgcatcgcctccgaggccttc
ctagccgacgtcgcgcgccaggtgctctcaggcatcgcctacctccaccgccgccacatc
gtccaccgcgacatcaagccttccaacctcctcatcgactccggccgccgcgtcaagatc
gccgacttcggcgtcggccgcatcctcaaccagaccatggacccctgcaactcctccgtc
ggcaccatcgcctacatgagccccgagcgcatcaacaccgacctcaacgacggcgcctac
gacgggtacgccggcgacatctggagcttcggcctcagcattctcgagttctacctcggc
aggttccccctcggggagaatctcggcaagcagggcgactgggccgctctcatgtgcgcg
atttgctactccgactcgccggctccgccgcccatcgcctccccagagttcaagagcttc
atcagctgctgcctccagaagaatccggcgaggcgtccgtccgccgcgcagctgctgcaa
caccgcttcatcgccgggccgcagccgcaggtcctcgccgccccaccgtcgtga

DBGET integrated database retrieval system