KEGG   Brachypodium distachyon: 100843743Help
Entry
100843743         CDS       T01717                                 

Definition
folic acid synthesis protein fol1-like
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
bdi  Brachypodium distachyon
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100843743
Enzymes [BR:bdi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     100843743
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     100843743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 535 aa AA seqDB search
MLHAKETVRKMYAVAKNYYGYYGGGLAAPNTFSALDLRKSLHSSGKAPGHVNLHSARSYT
QCAGAGGSADQEIVIALGSNVGDRIGTFDRALRLMRSLGIKITRHACLYETAPAYVTDQP
RFLNSAVRGTTKLGPHDLLKKLKEIEKDIGRTAGIRYGPRPIDLDILLYGNSQINTETLI
VPHERIHERPFVLAPLVDLLGSSADDCMEKSWHSLSKCSGGFFDLWNKLGGESVIGTEGI
KRVIPVGSRLLDWRERTLVMGVLNVTPDSFSDGGKFLEVAAAISQAKLLISQGADIIDIG
AQSTKPNATRLSANEELERLVPVLDAITKLPEMEGKLLSVDTFYAQVAAEAVKRGASMIN
DVSGGKLDPNILEVVAELGVPYVTMHMRGDPSTMQSEQNLQYDDVCKEVASELYERLREA
ELSGIPLWRIVLDPGIGFSKKSSQNLEVIRGLGSIRHEMAKMSLGASHVPILIGVSRKRF
LGEICNRVDPAERDVATVAAATAAIMNGANIIRVHNVGYGGDTAKVCDALRTGIS
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctccatgcgaaggagacagtcaggaagatgtatgccgttgccaagaactactacggc
tactacggtggagggctagcggcgccgaatacgttttcagcgttggatcttaggaagtct
ctccactcctcagggaaagcgcctgggcatgttaatctgcacagtgcccgatcgtatacg
caatgtgccggggcgggtggttctgccgaccaagagattgtgattgcactgggaagcaat
gtgggagataggatcggtacgttcgacagagcgctgcggctcatgagaagcttgggcata
aaaatcacgaggcacgcctgtttgtatgagactgcccctgcttatgtgaccgatcagcca
cggttcctgaactctgctgttaggggcacaactaagctgggacctcacgatctgctgaag
aagctgaaggagatcgagaaggatatagggcgcactgccggaataaggtatggtccaagg
ccaatcgatctagacattcttctgtatggtaactctcagatcaataccgagactctaatc
gtgccacatgaacgcatccatgagagaccgtttgttttagcacctcttgttgaccttcta
ggttcttctgccgacgattgtatggagaaaagctggcactctctctcaaagtgcagtggc
gggttctttgatttgtggaataagcttggtggtgaatctgtaattggaacagaaggtatt
aaaagggtaattcctgttggaagtcgtctgctggattggcgtgagaggacccttgttatg
ggagtgcttaatgtgacgccggacagctttagtgatggaggtaagtttctagaagtggca
gctgccatttctcaggccaagttgctaatatcacaaggggcagacattattgatatcggt
gctcaatccaccaagcccaatgcaacaaggctatctgcaaacgaagaacttgagaggctg
gttcctgttctggatgcaatcacaaaacttcccgagatggaagggaagttgctctcagta
gacacattctacgcgcaagttgctgctgaagctgtaaaaagaggagccagcatgattaat
gatgtatctggtggaaagcttgacccaaatattcttgaagttgtagctgaacttggagtt
ccatatgttaccatgcacatgagaggtgatccatcaactatgcaaagtgaacagaattta
cagtatgacgatgtctgcaaagaagttgcttctgagttatatgaacggttgagagaagca
gagttgtctggtattcctttgtggaggatagttcttgatcccggcattgggttctccaag
aaatctagtcagaatcttgaagttatcaggggcttgggatccattagacatgagatggcg
aaaatgagtttaggtgcttcacatgtgccaatattaattggagtctcaaggaaaagattc
ttaggtgaaatatgcaatcgtgtggatccagctgagagagatgttgctactgttgctgct
gctacagctgcgattatgaatggtgctaatataataagggtccataatgttgggtacggt
ggggatactgcaaaggtctgtgatgcattgcgtacgggcataagctga

DBGET integrated database retrieval system