KEGG   Brachypodium distachyon: 100844070Help
Entry
100844070         CDS       T01717                                 

Definition
AMSH-like ubiquitin thiolesterase 2-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
bdi  Brachypodium distachyon
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100844070
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100844070
Peptidases [BR:bdi01002]
 Metallo Peptidases
  Family M67
   100844070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 281 aa AA seqDB search
MSSARFESSGRKWQTHSTAGSKTMYLATADAKQIAHCQLNLPRAIDPNVGSYPVKHHYPS
PIVSWIEDLSSFSDVSFSDNAEYVDDQSRPSVGQSSASNNLHDMQISVRLTDEFMELAKE
NTSNNLETCGILGASFSDGTYYVTMLIIPKQDATAHSCQAFNEEEIHAILSEQSLYPAGW
IHTHPSQTCFLSSIDLHTQYSYQVMFPEAVAIVAAPTDPTRSYGIFRLTDPGGMDVLREC
SESGFHTHRETTDGGPIYETCSKVHFKPNLRFEIVDLRSGA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgcaagattcgaaagcagtgggcgaaaatggcagacacattcaacagcaggt
agtaaaacaatgtatttagctactgcagatgctaaacagatcgcccactgccaacttaat
cttccgagagcaatagatcccaatgttggttcctaccctgtgaagcaccactacccgtct
cctattgtttcctggatagaagacctttcgagctttagtgatgtttcttttagcgataat
gccgaatatgtggacgatcaatcaaggccttcagtggggcagtcttctgcatccaacaat
ttgcatgacatgcaaatctcggtaagactgacagatgaattcatggaacttgcaaaggag
aacacaagcaataatttggagacctgtggaattcttggtgcttcatttagtgatggaact
tactatgtgacaatgttgatcataccaaagcaagatgcaactgctcattcatgtcaagct
tttaatgaggaggagatacatgccatattgtcagagcagtcactttaccctgctgggtgg
atacatactcacccttcacaaacatgcttcctatcatcgatcgatttgcatactcaatac
tcttaccaggttatgttcccagaagctgttgccattgtggctgctcccactgatcctact
aggagctatggaatattcaggctgacagatccaggagggatggatgtgctcagggagtgc
agcgagagtgggttccacactcaccgagagacaacggatggcggtccaatatatgaaacc
tgctccaaggtgcacttcaaacctaatttgcggtttgagattgtcgatctgcgttctggt
gcgtga

DBGET integrated database retrieval system