KEGG   Brachypodium distachyon: 100844074Help
Entry
100844074         CDS       T01717                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100844074
Peptidases [BR:bdi01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100844074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 227 aa AA seqDB search
MGKRWIPLEANPDVMNQFMWGLGVAEGDVQFCDVYGLDDELLAMVPQPVLAVIFLYPLTS
KDEKVEEYDASATSTAGGKDSSKVYFTKQTVGNACGTIGVIHAIGNAASNIKLVEGSYFD
RFYKQTAGMDPVQRAAFLEEDDEMEGAHSIAASAGDTDVNVDVNEHFVCFSCVDGELYEL
DGRKSKPISHGPSSPDTLLQDAAKVIKARIATNPDSMNFNVMALSKQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggggaaacgatggatcccgctcgaggccaaccccgacgtcatgaaccagttcatgtgg
gggctgggagtcgccgagggggatgtgcagttctgcgacgtctacggcctcgacgacgag
ttgctcgccatggttccccagcccgtgctcgctgtcatcttcctctacccgcttacctcc
aaggatgagaaggtggaggaatacgatgcttctgccacctcgacggcagggggcaaggat
tcaagcaaggtgtactttacaaaacagactgttggcaatgcctgcggaacaattggcgtt
attcatgcaatagggaatgctgcatctaatatcaagcttgttgagggatcctattttgat
aggttttataaacaaacagcgggtatggatccagtccagcgtgccgcttttctcgaggag
gatgatgagatggagggtgctcattcaatcgctgcttctgctggtgacactgacgtcaat
gttgacgtgaatgaacattttgtgtgtttctcttgtgttgatggtgaactctatgagctt
gatgggcgaaaatcgaagccaatttctcatggcccttcatcacctgataccttgctgcag
gatgctgcaaaagtcatcaaagccagaattgcgacaaaccctgactctatgaacttcaat
gtcatggctctttcaaaacagtga

DBGET integrated database retrieval system