KEGG   Brachypodium distachyon: 100844075Help
Entry
100844075         CDS       T01717                                 

Definition
histone H2B.3-like
Orthology
K11252  
histone H2B
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 153 aa AA seqDB search
MAPKAEKKPAAKKPVEEEPAAEKAEKAPAGKKPKAEKRLPAGKTAAKEGGEGKKGKKKAK
KSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAGESAKLARYNKKPTITS
REIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaaggcagagaagaagccggcggcgaagaagcccgtggaggaggagcccgcg
gcggagaaggccgagaaggccccggccgggaagaagccaaaggcggagaagcggctgccg
gccgggaagacggcggccaaggagggcggcgaggggaagaagggcaagaagaaggccaag
aagagcgtcgagacctacaagatctacatcttcaaggtgctcaagcaggtgcacccggac
atcggcatctcctccaaggccatgtccatcatgaactccttcatcaacgacatcttcgag
aagctggccggggagtcggccaagctcgcgaggtacaacaagaagcccaccatcacctcc
agggagatccagacctccgtccgcctcgtcctccccggcgagctcgccaagcacgccgtc
tccgagggcaccaaggccgtcaccaagttcacttcctcttag

DBGET integrated database retrieval system