KEGG   Brachypodium distachyon: 100844116Help
Entry
100844116         CDS       T01717                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100844116
Enzymes [BR:bdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100844116
Chromosome and associated proteins [BR:bdi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100844116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET RicinB_lectin_2 FliH
Motif
Other DBs
NCBI-GeneID: 100844116
NCBI-ProteinID: XP_003577976
UniProt: I1IPA6
Position
4
AA seq 338 aa AA seqDB search
MKPEDVFNKLTRKLQDPADFVDFDLPPALKEWKLGYYIPIKRNVYLTKKRVEDDGIFCSC
PFISGSSVACGKDCQCGMLFSCCSSNCKCENRCANKSFQLRPLKKTKLIKTEKCGFGLVA
DDGIQKGEFIIEYVGEVIDDRTCEERLWKMKRQRYTNFYLCEVSSNMVIDATNKGNKSRF
INHSCQPNTEMQKWTVDGETRVGIFALRDIKKGEELTYDYKFVQFGADQDCHCGSSKCRK
MVGTSKSVNSIILHNGNSGSSQDQHIVKKRKITSDNCIGEIIRLWDRRDKMYVPAVIYDY
DEYTAMHTLLFDEETTEKFDLGEEDWNFLPRPEDPDED
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgaagatgttttcaataaattgaccaggaaactgcaagatcctgcggatttt
gtagattttgatctgccacctgcgttgaaagaatggaagttaggctactatataccaatt
aagcgaaatgtttatcttactaagaaacgggttgaagatgacggcattttctgttcttgc
ccttttatttctggatcatcagtcgcttgtggaaaagattgccaatgcgggatgctgttc
tcttgttgttcatcaaactgcaaatgtgagaataggtgtgccaataaatcattccagctc
aggcctctgaaaaaaaccaaattgatcaagacagagaaatgtggctttggattggtagct
gatgatggaatacagaaaggagagtttattatagaatatgtaggagaagttattgatgac
agaacttgtgaggaaagactatggaaaatgaagagacagcgctacactaatttttacctt
tgtgaggtcagtagcaacatggtcattgatgcaacaaacaagggaaacaagtcaaggttt
atcaatcatagttgtcaacctaacacagagatgcagaaatggactgtagatggagagacc
agagtaggaatttttgctcttcgtgacataaagaaaggagaggagctaacctatgactat
aaatttgtccagtttggagcagatcaagattgccactgtggatcttcaaaatgcagaaaa
atggttggcacctctaagtcggtcaactcaattattcttcacaatggcaactcaggaagc
tcacaagatcagcatattgtgaaaaaaagaaagataacctcggataattgtattggggag
attatccgtttgtgggatcgacgggacaaaatgtatgtcccagcagttatatatgactat
gatgagtacactgcaatgcatactttactgtttgatgaagaaactactgaaaaatttgat
ttgggagaggaagattggaacttcctaccgcgtccagaagatccagatgaagactga

DBGET integrated database retrieval system