KEGG   Brachypodium distachyon: 100844158Help
Entry
100844158         CDS       T01717                                 

Definition
(RefSeq) acyl-protein thioesterase 1 homolog 1
  KO
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
bdi  Brachypodium distachyon
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100844158
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100844158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 255 aa AA seqDB search
MSFGGGSSVAAGAKRPFEYGRTHVVRPKGAHKATIVWLHGLGDNGASWSQLLETLPLPNI
KWICPTAPTRPVAIFGGFPSTAWFDVADLSEDSPDDVEGLDASAAHVANLLSTEPADIKL
GVGGFSMGAATALYSGTCFAHGKYGNGNPYPVNLSLAVGLSGWLPCARSLKNKIESSQEA
AQKASLLPLLLCHGKADDVVLYKHGERSVDALKSTGFSNVVFKSYNRLGHYTVPEEMDEV
GKWITASLEISSSSS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcggcggtggcagctccgtcgcggccggtgcgaagcggccgttcgagtacggc
cggacgcatgtggtgaggcccaagggcgcgcacaaggccaccatcgtctggctccacggc
ctcggcgacaatggagccagctggtctcaactgttggaaactcttccccttcccaatata
aaatggatttgcccaactgcgcctacgaggcctgtggcaatctttggcgggttcccatct
actgcatggtttgacgttgccgatctttcagaagattctcctgatgatgttgaggggctg
gatgcctcagctgcacatgttgcaaatcttttgtcaactgagcccgcggacatcaagctt
ggcgttggtggctttagtatgggtgctgctactgccctttactctgggacttgctttgct
catgggaaatatgggaatggcaatccatatccagtgaacttaagtttagctgtgggtctg
agtggctggcttccatgtgccaggtcattgaagaacaaaattgagagctctcaggaggct
gcacaaaaggcttcattgttacctcttctcctttgtcatggaaaagctgatgacgtagtt
ctttacaagcatggagagagatctgtcgatgcactgaagtcaactggattttcaaatgtg
gtattcaagtcatataacagacttggacactacaccgttccagaggagatggacgaagtc
ggcaaatggatcacagcaagcttggaaatcagtagttcatcgtcttga

DBGET integrated database retrieval system