KEGG   Brachypodium distachyon: 100844223Help
Entry
100844223         CDS       T01717                                 

Definition
aldose 1-epimerase-like
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bdi  Brachypodium distachyon
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bdi00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bdi00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 367 aa AA seqDB search
MARVPLLVALCLVCFASGASAAGRKMVGVYELRKGDFSVKVTNWGATVTSVVFPDSKGNL
GDVVLGYDTIAEYVNGSSYFGALVGRVANRVAKARFVLDGKVYNLYANDGKNALHGGHRG
FSKVIWTVKEYVAGGDSPHITLYYHSFDGEQGFPGDLDVYVTYELSSPYVLRVRMNATAL
DKATPVNLAQHTYWNLGGQGSGRDVLGHTVQLFAAHYTPVDGTLIPTGQLAPVAGTPYDL
RTPTAVGARVRQVSGGSSNGSAVYGFDINYAVDGEDARALRKVAVVRDGASGRAMELWAD
QPGVQFYTGNFLKDVKGKGGAVYGQYGALCLETQGFPDAVNQPGFPSQIVRPGQAAYKHD
MVFKFSF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggctagagtgcctcttctcgtcgcgctgtgcctcgtgtgctttgccagtggcgccagt
gcagcggggaggaagatggtgggcgtgtatgagctcaggaagggagatttctccgtcaag
gtcaccaactggggcgccaccgtcacgtccgtcgtctttcctgattccaaagggaatttg
ggtgatgttgtccttggctatgacaccattgctgaatatgtgaatggatctagttacttt
ggagcgcttgtcggacgagtagccaacagagttgccaaggcacgcttcgtgcttgatgga
aaagtctacaacctgtacgccaacgacggcaagaacgcacttcacggtggccataggggt
ttcagtaaagttatatggacggtgaaggaatatgttgctggcggtgactccccacacatc
acactatactaccatagttttgacggagaacaagggttccccggtgacctggacgtgtac
gtgacgtacgagctgtcgagcccgtacgtgctgcgcgtgcgcatgaacgcgacggcgctg
gacaaggccaccccggtgaacctggcgcagcacacgtactggaacctgggcgggcaagga
agcggccgcgacgtgctgggccacacggtccagctcttcgcggcccattacacgcccgtg
gacggcacgctgatcccgacggggcagctggctcccgtggccggcacgccctacgacctc
cggacgccgaccgccgtgggcgcgcgcgtccggcaggtgtccggcggcagcagcaacggc
agcgccgtctacggcttcgacatcaactacgccgtggacggggaggacgcgcgcgcgctg
aggaaggtggccgtggtgcgggacggcgcgtccgggcgggcgatggagctgtgggcggac
cagcctggggtgcagttctacaccggcaattttctcaaggacgtcaaagggaaaggcggg
gcggtttacgggcagtacggcgcgctgtgcctcgagacgcaggggttccccgacgccgtc
aaccagccgggcttcccgtcgcagattgtaaggccggggcaggccgcgtacaagcatgac
atggttttcaagttctccttctag

DBGET integrated database retrieval system