KEGG   Brachypodium distachyon: 100844223Help
Entry
100844223         CDS       T01717                                 

Definition
aldose 1-epimerase-like
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bdi  Brachypodium distachyon
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100844223
   00052 Galactose metabolism
    100844223
Enzymes [BR:bdi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100844223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 367 aa AA seqDB search
MARVPLLVALCLVCFASGASAAGRKMVGVYELRKGDFSVKVTNWGATVTSVVFPDSKGNL
GDVVLGYDTIAEYVNGSSYFGALVGRVANRVAKARFVLDGKVYNLYANDGKNALHGGHRG
FSKVIWTVKEYVAGGDSPHITLYYHSFDGEQGFPGDLDVYVTYELSSPYVLRVRMNATAL
DKATPVNLAQHTYWNLGGQGSGRDVLGHTVQLFAAHYTPVDGTLIPTGQLAPVAGTPYDL
RTPTAVGARVRQVSGGSSNGSAVYGFDINYAVDGEDARALRKVAVVRDGASGRAMELWAD
QPGVQFYTGNFLKDVKGKGGAVYGQYGALCLETQGFPDAVNQPGFPSQIVRPGQAAYKHD
MVFKFSF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggctagagtgcctcttctcgtcgcgctgtgcctcgtgtgctttgccagtggcgccagt
gcagcggggaggaagatggtgggcgtgtatgagctcaggaagggagatttctccgtcaag
gtcaccaactggggcgccaccgtcacgtccgtcgtctttcctgattccaaagggaatttg
ggtgatgttgtccttggctatgacaccattgctgaatatgtgaatggatctagttacttt
ggagcgcttgtcggacgagtagccaacagagttgccaaggcacgcttcgtgcttgatgga
aaagtctacaacctgtacgccaacgacggcaagaacgcacttcacggtggccataggggt
ttcagtaaagttatatggacggtgaaggaatatgttgctggcggtgactccccacacatc
acactatactaccatagttttgacggagaacaagggttccccggtgacctggacgtgtac
gtgacgtacgagctgtcgagcccgtacgtgctgcgcgtgcgcatgaacgcgacggcgctg
gacaaggccaccccggtgaacctggcgcagcacacgtactggaacctgggcgggcaagga
agcggccgcgacgtgctgggccacacggtccagctcttcgcggcccattacacgcccgtg
gacggcacgctgatcccgacggggcagctggctcccgtggccggcacgccctacgacctc
cggacgccgaccgccgtgggcgcgcgcgtccggcaggtgtccggcggcagcagcaacggc
agcgccgtctacggcttcgacatcaactacgccgtggacggggaggacgcgcgcgcgctg
aggaaggtggccgtggtgcgggacggcgcgtccgggcgggcgatggagctgtgggcggac
cagcctggggtgcagttctacaccggcaattttctcaaggacgtcaaagggaaaggcggg
gcggtttacgggcagtacggcgcgctgtgcctcgagacgcaggggttccccgacgccgtc
aaccagccgggcttcccgtcgcagattgtaaggccggggcaggccgcgtacaagcatgac
atggttttcaagttctccttctag

DBGET integrated database retrieval system