KEGG   Brachypodium distachyon: 100844241Help
Entry
100844241         CDS       T01717                                 

Definition
xylose isomerase-like
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bdi  Brachypodium distachyon
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100844241
   00051 Fructose and mannose metabolism
    100844241
Enzymes [BR:bdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     100844241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 479 aa AA seqDB search
MKGAELLTLLVASFLCLSAAIAAQETCPADLDAKCGDGASDDWEGEFFPGIPKIKYEGPT
SKKPLSYKWYNAEEVILGKKMKDWLRFSVAFWHTFRGTGGDPFGAPTKVWPWEDGTNSLA
MAKRRMKAHFEFMEKLGVDRWCFHDRDIAPDGKTLAETNANLDEIVKLAKQLQGETNIKP
LWGTAQLFMHPRYMHGAATSPEVKVYAYAAAQVKKALEVTHYLGGENYVFWGGREGYQTL
LNTDMKRELEHLANFLQAAVDHKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFSFLQKY
GLTGEFKINVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQVGWDTDEFLTDISE
ATLVMSSVVKNDGLAPGGFNFDAKLRRESTDVEDMFIAHISGMDTMARGLRNVAKLIEDG
SLDELVRKRYQSFDTEIGAMIEAGKGDFETLEKKVLEWGEPIVPSGKQELAEMLFQSAL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgcagaactcttgaccttgctggtggcgtcgtttctgtgcctgtctgctgcg
attgctgcgcaggagacttgcccggctgacctggacgcaaagtgcggggatggggcttct
gatgactgggagggcgagttcttccctggcattcccaaaattaagtatgagggtccaacc
agcaagaaaccgctttcttacaagtggtataacgcggaggaagtgattctcggaaagaaa
atgaaagattggttgcggttcagcgtggccttttggcatacattccgtggcactggagga
gatccttttggtgcccctacaaaggtttggccttgggaagatggcacaaattctttggcc
atggctaagcgaagaatgaaagctcactttgagttcatggagaagcttggagttgacaga
tggtgtttccatgatagggatatcgcccctgatggcaaaacacttgcggaaacaaatgct
aacttggatgagatagttaagctggcaaagcaactccagggtgagaccaacataaagcca
ttgtgggggactgcacagcttttcatgcatccacgttacatgcacggagctgctactagc
ccagaggtcaaagtgtacgcctatgctgctgctcaagtgaagaaagctttggaggttact
cactacctaggcggtgaaaactatgtattctggggtggaagggagggttaccagactctt
cttaataccgatatgaagagagaactggaacatttggctaactttcttcaagctgctgtt
gatcacaagaagaagattggctttaacggaacattgttgattgagcctaaaccacaagaa
ccaacaaagcatcagtatgactgggatgttgcaactacattctctttccttcagaagtat
ggtcttacaggagaattcaagataaatgtcgagtgcaaccatgctactctctctggccat
agttgccatcatgagcttgagactgcacgcattaatggtttgcttggaaacattgatgca
aacactggtgatccccaagttggttgggacacagatgagttccttacagatatttcagag
gctactttggttatgtcaagtgtagttaagaatgatgggcttgcacctggtggcttcaac
tttgacgctaaattgcggagggagagtactgatgttgaggacatgtttattgctcatatc
tcagggatggacaccatggctcgtggcctccgcaatgttgcgaagctgattgaggatggt
tccctggatgagcttgtccgtaagcgttaccaaagctttgatactgagattggtgccatg
attgaggccgggaaaggagactttgaaacactagaaaagaaggtcttggagtggggtgaa
cccattgttccatctggcaaacaggaactggctgagatgctgttccagtctgctctatag

DBGET integrated database retrieval system