KEGG   Brachypodium distachyon: 100844309Help
Entry
100844309         CDS       T01717                                 

Definition
(RefSeq) regulatory-associated protein of TOR 2
  KO
K07204  
regulatory associated protein of mTOR
Organism
bdi  Brachypodium distachyon
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 1259 aa AA seqDB search
MKTGCVALVLCLNISVDPPDVIKISPCARMECWIDPFSMAPPKALETIGKTLHSQYDRWQ
PKARYKLQLDPTVEEVKKLCNTCRKYARSERVLFHYNGHGVPKPTANGEIWVFNKSYTQY
IPLPITDLDSWLKTPSIYVFDCSAAGMIVKAFLERLDWSSSSSASSSKDCILLAACEAHQ
TLPQSAEYPADVFTACLTTPIKMALHWFCKRSLFRGSLDHSLIDQIPGRQNDRKTLLGEL
NWIFTAITDTIAWNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMRSANCSPITYPLLPP
THQHHMWDAWDMSAEICLSKLPQLIADPNAEFQPSPFFTEQLTAFEVWLDHGSEDKKPPE
QLPIVLQVLLSQSHRFRALVLLGRFLDMGPWAVDLALSVGIFPYVLKLLQTSAMELRQIL
VFIWTKILSLDKSCQVDLVKDGGHAYFIRFLDSLDAYPEQRAMAAFVLAVIVDGHRGGQE
ACINAGLIDVCLRHLQPENPHDAQTEPLLLQWLCLCLGKFWEDFPEAQLLGLQSNAPEIV
ACLLSEPQPEVRASAVFALGNLLDIGSPSQNGGDDDSDDDEKVRAEINVVRSLLQVSSDG
SPLVRAEVSVALTRFALGHNKQLKIVAAEYWRPQTNSLLKSLPSLANINNPSNAYTPSNF
LQGSSGLSSHIGPVLRVGSDNSATGRDGRISTSSPIATNSIMHGSPQSDDSSQHSDSGIL
LRENASNGGTSYTRSRPIIDSGIYTQFISTMCSVAKDPYPRIASIGRRALSLVGVEQVVM
RNTRFGSGGAHPGETSAPPSLNIGMARSSSWFDMNSGNFSMSFRTPPVSPPQHDYLTGLR
RVCSMEFRPHLLNSPDGLADPLLSSAATPSTSELNILPQSTIYSWSCGHFSRPLLTGSDD
NGEVSARREERERTALDCIAKCQRSSACKMTSQIASWDTKFELGTKSALLLPFSPIVVAA
DENEQIRVWNYDDALPVNTFENHKLSERGLSKLLLINELDESLLLVGSSDGNVRIWRNYT
QKGGQKLVTAFSSVQGNRAAGRSVVIDWQQQSGYLYSSGDMSSILVWDLDKEQLLSTIQS
SADSGISALSASQVRCGQFAAGFLDASVRIFDVRTPDRLVYTAKPHAPRTEKVVGIGFQP
GFDPYKIVSASQAGDIQFLDVRRAAEPYLTIEAHRGSLTALAVHRHAPVIASGSAKQMIK
VFSLEGEQLTLIRYQPSFMGQRIGSVNCLSFHPYKSLLSAGAGDNALVSIYAEDNYQVK
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccggatgtgttgcacttgtattatgtttgaacattagtgttgatccaccagat
gtaattaaaatttccccttgcgcaaggatggagtgttggatagatccattttctatggca
cctcccaaagctcttgaaaccattggaaaaacattacactcacaatatgatcgatggcaa
cctaaggctcgttacaagcttcagctggatccaacagttgaagaagtaaagaaactttgt
aatacctgtcgcaaatatgccaggtcagagagagttctttttcattacaatggtcatggt
gtaccaaagcctacagctaatggagagatttgggtgtttaacaagagttacacacagtat
atccccctccccattactgatctcgattcatggctgaaaacaccatctatttatgttttt
gactgctcagcagctggaatgattgtgaaagcttttctagagcgcctagactggagttcg
agctcttctgcatcttcatcaaaggattgcattctccttgctgcctgcgaagcacatcaa
actcttccacagagtgcagaatatcctgccgatgtgtttacagcttgcctgaccacaccc
atcaaaatggcattgcactggttttgtaaacgatcattattccgtggttctctggatcac
tctcttatcgaccaaattcctggaaggcaaaatgaccgtaaaacacttctgggggagttg
aactggattttcaccgccattacagatactattgcatggaatgttcttcctcatgatcta
tttcaaaggcttttcaggcaggatcttttggttgctagtctcttccgcaacttcttactt
gctgagaggatcatgcgatctgcaaattgttctccaattacctacccgttgttaccaccc
acacatcaacaccacatgtgggatgcatgggacatgtctgcggagatttgcctttccaag
cttcctcaattgattgccgatcctaatgcagaatttcagccgagcccattttttacggaa
caattgacagcatttgaagtgtggcttgatcatggctctgaggataagaaaccccctgaa
cagttacccattgttcttcaggtattacttagtcaatcacacagatttagagcgcttgtt
ctgcttggaagatttcttgacatggggccatgggcagttgatttggccttgtctgttggt
atcttcccttacgtcctcaaactgcttcaaacaagtgcaatggagctgcgtcaaattctt
gtgttcatatggacaaaaattctctcccttgataagtcatgccaggttgatttggtgaaa
gatggggggcatgcatatttcatcaggtttcttgacagtttggatgcttacccggagcag
cgtgcaatggctgcttttgttttagcagttattgtggatgggcatagagggggtcaagag
gcttgcattaatgcaggtcttatagatgtttgcctgaggcatcttcagcctgagaatcct
catgatgcacagacagaacctttgcttttgcaatggctttgtttatgccttggtaaattc
tgggaagattttcctgaggctcagttgcttggtctacaatctaatgccccagaaattgtt
gcatgtttattgtctgagcctcaacctgaggtcagagcctctgctgtttttgcacttgga
aatctgttggatattggatctccatcacagaatggaggcgatgacgactctgatgatgat
gaaaaggtgagagctgaaataaatgttgttcggagccttctgcaagtctcttcagatggc
agccctcttgtgagagctgaggtttctgtagctcttacacgcttcgcattgggccacaac
aaacaactcaaaattgttgctgcggagtattggagacctcaaacgaattcactgctaaag
tcactaccgtcactggctaatattaataaccccagcaatgcttacactccaagcaacttt
ctgcaaggcagcagcggtctatcttctcacatcggtcctgtgttaagggttggtagcgat
aacagtgccacaggtcgtgatggaagaatttctacaagcagcccgattgcgacaaatagc
atcatgcatgggtctccccagtcagatgattcttcgcaacattctgattcaggcatattg
ctgagagaaaatgctagtaatggtggtaccagctacaccaggtcaaggcctattattgat
agtgggatttatacccaatttatatcgactatgtgctctgttgctaaagatccttacccg
agaattgcaagtattggccggagagcactttctcttgtgggggtcgagcaagtggtcatg
agaaatactagatttggcagcgggggtgcacatcctggagaaacatctgctcctccatca
ttaaacattggaatggcacgctcttcttcctggtttgacatgaattctggaaatttttca
atgtcattcaggaccccccctgttagtccccctcagcatgactaccttacagggttgcgt
cgagtctgttccatggagttcagaccacatcttttgaattcgcctgatggcttagctgat
ccgctcttaagctctgctgcaacccccagtaccagtgagcttaatatacttccccaatca
acaatttacagctggagttgtggccacttctcaaggccgcttctaaccggctctgatgac
aatggggaagtaagtgctagaagagaagagcgagaacgcactgcactggattgtattgcg
aagtgccagcgttcctcagcatgcaagatgactagccaaattgctagttgggatacaaag
tttgagttgggtacaaaatcagcactattgttaccgttttctccaatcgttgttgcagct
gatgagaacgagcagataagagtgtggaactatgacgatgctctaccagtgaatactttt
gaaaaccataagttgtctgagagagggctatccaaacttttgcttatcaatgagcttgat
gaaagcttgcttttagttggctcaagtgatggaaatgtccgtatatggagaaactatact
caaaagggaggacagaaacttgtaactgctttctcatcagttcagggcaatcgagctgct
ggtcgcagtgttgtgatcgactggcaacagcaatcgggttatctgtattcctctggtgac
atgtcttccatccttgtgtgggatcttgacaaagagcaacttctcagcaccattcagtca
tctgctgatagcggcatatcagctctgtctgcatctcaggttcgatgtggtcagtttgct
gctggttttcttgacgcgtccgtgaggatatttgatgttcgtactcctgataggctagtt
tatactgcaaaaccacatgccccaagaactgaaaaggttgtcggaataggatttcagcct
gggtttgatccatacaagattgtaagcgcatctcaagctggagacattcagtttcttgat
gttagaagggcagctgagccctacctcactatcgaagctcacaggggatcattaacggca
ttagctgttcatcgacatgccccagtcattgcaagtggctcagctaagcaaatgattaaa
gtgttcagtcttgaaggagaacagctaacgctcattcgataccagccatcttttatgggc
caaagaataggcagtgtaaactgcctttctttccatccatacaaatctctcctgtccgct
ggtgctggtgataatgctctagtctctatctatgctgaggacaattatcaagtaaaatga

DBGET integrated database retrieval system