KEGG   Brachypodium distachyon: 100844418Help
Entry
100844418         CDS       T01717                                 

Definition
folic acid synthesis protein fol1-like
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
bdi  Brachypodium distachyon
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bdi00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 515 aa AA seqDB search
MVIVTGNVELELYPRQPIDPLTRAKTNFSRHRSFAESSLKASSREQEIVIALGGNVGDRI
SNFNSALQLMKDSGISILRHAWLYEXVPAYVTNRPPFLNSAVRGTTKLGPHDLLRLLKKI
EKDLGRTDGIRYGPRPIDLDILFYGKHHINSESLTIPHERIHKRPFVMAPLMDLVRTSTE
TDVEASWHSLSKCSDGLFKIWENLGGESLIGKEGLRRVLPVGDELLDFAERTHVMGILNL
TPDSFSDGGKFQEVEAAVNQVKLLVSEGADIIDIGAQSTRPSARRLSVGEELERLVPVLD
AVMKIPEIEGKLLSVDTFYAEVAAEAVSRGVHIVNDVSAGHLDPKILEGVRELGVPYIVM
HMRGDPSTMQSDQNLQYEDVCKQVASELYSRVRSAEMAGIPLWRLIVDPGIGFSKDSKQN
LQLLAGLSSVRREMSKTSVGASHMPMLVGLSRKRFLGEICNHASPVERDPATVSAATSAI
LGGXNIISVHNARFGVDTAKICDALLKQRNTRELF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcgttacaggcaatgtggagctggaattatacccaaggcagcctattgaccca
ttaacaagagcaaagacaaatttctcaaggcaccgttcatttgcagaatcatcactgaag
gcaagctcccgagagcaagagattgtcattgctttagggggaaatgtgggtgacagaatc
agtaactttaattcagcccttcaactcatgaaagattcaggcataagcattcttcgacac
gcatggttgtatgaangtgtgcctgcatatgtcaccaatcgaccaccattcctcaactct
gctgtcagagggacaacaaaactcgggcctcatgacttactcagactactcaaaaaaatt
gagaaggatttgggccgaacagatgggataagatatggccctagaccaattgatcttgat
attttgttctatggtaagcaccacataaactctgaatctttgacaataccacatgaaagg
atacacaagaggccatttgttatggctccgctaatggatctggtaagaacatctactgaa
actgatgtggaagcaagttggcattcactctcaaaatgcagtgatggtctcttcaaaatt
tgggagaaccttggaggagagtccttgattggaaaagaaggcctaagaagggttttgcct
gtaggtgatgagctgttggattttgcagagagaactcatgtcatgggcatacttaatctg
acaccagatagttttagcgatggaggaaaatttcaagaagtggaggctgctgttaatcag
gtcaagttgcttgtatctgaaggtgcagatattattgacattggggcacaatcgacacgt
ccttctgcgagaaggctctcggtgggtgaagagcttgaaagattggttcctgtgcttgat
gccgtcatgaagataccagaaatagaagggaagctgttatcagtggacaccttctatgca
gaagttgcagcagaagctgtgagtcgaggagtgcatatagtcaatgatgtgtctgctgga
catcttgaccctaaaattcttgaaggtgtcagggaacttggtgttccatacatcgtaatg
catatgagaggggatccatccacgatgcaaagtgatcaaaatttgcagtatgaagatgtt
tgcaagcaagtggcctctgagttatactcgagagtgcgcagcgcagaaatggcaggaatt
cctttgtggagattgattgtcgaccctgggatcggtttctcaaaagattccaaacagaac
ctccagcttcttgctggtctatcatccgtaagaagagagatgagcaaaacaagtgttggt
gcttcacatatgccaatgttagttggactatccaggaaaagatttctaggtgaaatatgt
aaccatgccagtcctgttgagagggatcctgctacggtctctgctgctacgtctgctata
ttgggtggtngcaacataattagcgtacacaatgccagatttggtgttgatactgcaaag
atatgtgatgcactactcaagcaaagaaacactcgggaattattttga

DBGET integrated database retrieval system