KEGG   Brachypodium distachyon: 100844522Help
Entry
100844522         CDS       T01717                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00010  Glycolysis / Gluconeogenesis
bdi00052  Galactose metabolism
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100844522
   00052 Galactose metabolism
    100844522
Enzymes [BR:bdi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100844522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 100844522
NCBI-ProteinID: XP_003579893
UniProt: I1IYG2
Position
5
AA seq 362 aa AA seqDB search
MARTPVFLALLSLVVVASALATTADARKMVGVYVLKKGDFSVKITNWGATIMSIVFPDSK
GNLGDVVLGKDTLAEYVNDTSYFGPLTGRVAQRMARGRFVLDGKVYHTYINDGRNAIHGG
HRGFSKVIWTVKEYVGGGDSPHITLYYRSFDGEQGFPGDLDVYATYSLSSPYVLSIRTNA
TALNKATPVNFLQHTYWNLGGKGSGNILGHTLQLFASRYTPMDDELLPSSGRVVPVAGTP
YDFRTPTPIGARIRQVTGSNKVFGYDINYVVDGEGMRKVAVARDGASGRALEFWANQPAM
QLYTGNYLNGTKGKGGEVYQQYGGFALETQGYPDAVNHPEFPSQTLRLGQVYKHDMLIKF
SF
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggactccggtgtttctcgcgctcctcagccttgtggttgtggcctcagcgcta
gccaccactgccgatgcgaggaagatggtcggcgtgtatgtgctcaagaaaggggatttc
tccgtcaagatcaccaattggggagccactatcatgtcgattgtctttcctgattccaaa
gggaatttgggcgatgttgtgctgggtaaagacaccctcgctgaatatgttaacgacacc
tcttactttgggccactgaccgggcgcgtggcgcaaagaatggctaggggccgattcgtc
ctcgacggcaaagtgtaccatacgtacatcaacgacggcaggaatgcaattcatggtggt
cacaggggattcagcaaggtgatatggacggtgaaggaatacgttggtggcggcgactcc
ccacacatcactctgtactaccgcagcttcgatggagagcaaggattccccggagacctg
gacgtgtacgcgacgtacagcctgtcgagcccgtacgtgctgagcatccgcacgaacgcg
acggcgctgaacaaggccacgccggtgaacttcctgcagcacacgtactggaacctggga
gggaaagggagcggcaacatccttggccacacgctgcagctcttcgcgtcccggtacacc
ccgatggacgatgagctcctgccgtcgtcgggccgcgtggtgcccgtggccggcacgccc
tacgacttccggaccccgacgccgatcggcgcgcgcatccggcaggtcactggctccaac
aaggtcttcggctacgacatcaactacgtcgtcgacggggaaggcatgcggaaggtggcc
gtggcgcgggacggcgcgtccgggcgcgccctggagttctgggccaaccagccggccatg
cagctctacaccggcaactatctgaacggcaccaagggcaagggcggggaggtgtatcag
cagtacggcgggttcgcgctcgagacgcagggatatccggacgccgtgaaccaccccgag
ttcccgtcgcagacgctgaggctcggccaagtgtacaagcatgacatgctcataaaattc
tccttctag

DBGET integrated database retrieval system