KEGG   Brachypodium distachyon: 100844752Help
Entry
100844752         CDS       T01717                                 

Definition
tryptophan synthase beta chain 2-like
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bdi  Brachypodium distachyon
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100844752
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100844752
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100844752
Enzymes [BR:bdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     100844752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 490 aa AA seqDB search
MAAASIALHPPRLQGPGKAALPPRIPNRSRVTVSGTRSFATRAGSNPGNVSIPKQWYNLV
ADLPVKPPPQLHPQTHQPLKPSDLSPLFPDELIRQELTEERFVDIPEEVRDVYELWRPTP
LIRAKRLEKLLGTPAKIYYKYEGTSPAGSHKANTAVPQAFYNAAAGVKSVVTETGAGQWG
SALSFASTLFGLTCEVWQVRASYDQKPYRRLMMETWGAKVHPSPSEATESGRKLLAADPS
SPGSLGMAISEAVEVAATNGDTKYCLGSVLNHVLLHQTVIGEECLEQLAAIGDTPDVVIG
CTGGGSNFGGLAFPFMREKLAGRINPVFKAVEPAACPTLTKGVYAYDYGDTAGLTPLMKM
HTLGHGFVPDPIHAGGLRYHGMAPLISHVYELGFMEAMSIQQTECFEAALQFARTEGIIP
APEPTHAIAAAIREALECKRTGEEKVILIAMCGHGHFDLAAYDRYLRGDMVDLSHSSEKL
KESLAAIPKV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcttccatcgcgcttcaccctccacggctccaaggcccagggaaagctgca
ctccctcctcgcataccaaacaggagcagagtcactgtcagcggtacaaggagcttcgcc
accagagccggctcgaatccggggaacgtgagcatcccgaagcaatggtacaacctggtg
gccgacctgccggtgaagccgccgccgcagctgcacccgcagacgcaccagccgctgaaa
cccagcgacctgtcccctctcttccccgacgagctcatccgccaggagctcaccgaggag
cggttcgtcgacatcccggaagaggtccgcgacgtctacgagctctggcgccccacgccg
ctcatccgggccaaacgcctagagaaacttctcggcacgccggcgaagatctactacaag
tacgaaggcactagcccggcagggtcgcacaaggccaacacggccgtgccgcaggcgttc
tacaacgccgcggcgggggtgaagagcgtcgtcaccgagaccggcgccgggcagtggggc
agcgcgctctccttcgccagcacgctcttcggcctcacctgcgaggtctggcaggtgcgc
gcgtcctacgaccagaagccgtaccgaaggctgatgatggagacctggggagccaaggtg
cacccttcgccgtcggaggccacggagtccgggcggaagcttctcgcggcggacccgagc
agcccgggcagcctcggcatggcgatctcggaggcggtggaggtcgcggccaccaatggg
gacaccaagtactgcctcggcagcgtgctcaaccacgtgctgcttcaccagaccgtcatc
ggcgaggagtgcctggagcagctggccgccattggcgacacccctgacgtcgtcatcggc
tgcaccggcggcggctccaacttcggggggctcgcgttccccttcatgcgcgagaagctt
gctggcaggattaacccggtgttcaaggccgtcgagcccgcggcctgcccgacgctcacc
aagggggtttatgcttatgactatggcgacacggccgggctcacgccgctcatgaagatg
cacacgcttgggcatggctttgtccccgatcccatccacgcaggtgggcttcgttaccat
ggaatggcacctctgatctctcatgtgtatgagcttgggttcatggaagctatgtccata
cagcaaaccgaatgcttcgaagctgccttgcaatttgcgcggacggaggggatcatcccg
gcgccggagccgacgcacgccatcgcggcggcgatcagagaagcgctggagtgcaagaga
acaggggaggagaaggtcatcctcattgcgatgtgcggccacggccacttcgacctcgcc
gcctacgaccggtacctgagaggcgacatggttgatctgtcgcactcctccgagaagctg
aaggagtcgctagccgccattcccaaggtctga

DBGET integrated database retrieval system