KEGG   Brachypodium distachyon: 100844934Help
Entry
100844934         CDS       T01717                                 

Definition
3'(2'),5'-bisphosphate nucleotidase-like
Orthology
K15422  
3'(2'), 5'-bisphosphate nucleotidase / inositol polyphosphate 1-phosphatase [EC:3.1.3.7 3.1.3.57]
Organism
bdi  Brachypodium distachyon
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100844934
  Energy metabolism
   00920 Sulfur metabolism
    100844934
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100844934
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100844934
    3.1.3.57  inositol-1,4-bisphosphate 1-phosphatase
     100844934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 424 aa AA seqDB search
MAARVGLSHALLASSSLARNPPPRARLLPYPTLLPLPTYRRSVSASASALPSLRRRRPFA
ARAMSQPPEAAGSPYAAELAAAKKAVALAARLCQTVQQELVQSDVQSKADKTPVTVADYG
SQILVSLVLNMEVTSGSFSMVAEEDSEDLRKEGAEEILEHITDLVNETLAEDGSFNISLS
QEGILSAIDSGKSEGGPSGRHWVLDPIDGTKGFVRGGQYAIALALLDEGKVVLGVLGCPN
LPLTSICNLNGNSSGDQTGVLFSATIGCGAEVQSLDGSPPQKISVCSIDNPVNASFFESY
EGAHNMRDVTGSIAEKLGVQAPPVRIDSQAKYGALARGDGAIYLRFPHKGYKEKIWDHAA
GSIVVTEAGGIVTDASGKDLDFSKGRCLDDLDTGIVATNKQLMPSLLKAVQEAIKEKNQA
PSPL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcgcgtgggcctctcgcacgcgctcctcgcgtcctcctccctcgcccgaaac
cctccacctcgtgctcgcctcctcccttatcccactctcctccccctccccacctaccgc
cgatccgtctccgcctccgcctcagccctccccagcctccgccgccgccgcccctttgcc
gcccgcgctatgtcacagccaccggaggccgccgggagcccctacgccgccgagctcgcc
gccgcaaagaaggccgtcgccctcgccgcccgcctctgccagacggtgcaacaggaactt
gtgcaatcggatgttcagtccaaggcggataagactcctgtcacagtagctgattatgga
tctcaaatattggtaagtctcgtgttgaatatggaagtaacctctggttccttttctatg
gtggcggaggaggactctgaagacctgaggaaagagggtgcggaagaaattttggaacac
attaccgatcttgtaaatgaaactcttgcagaggacggttccttcaacatttcattatct
caggaaggtatcctctctgcaattgatagcgggaagtctgagggaggtccatctgggcga
cattgggttctagatccaatcgacgggactaaaggtttcgtaagaggaggccaatatgca
attgcactggccttgcttgatgagggcaaagtcgttctaggtgtattgggatgtccaaat
cttcctttgacatcaatatgcaacctcaatggtaactcatcaggtgatcaaactggagtc
ctcttttcagctacaattggttgtggcgctgaagtacagtccttagatggctctccacca
caaaagattagtgtttgctccatcgacaatccagtcaatgcctcgttctttgaatcctat
gaaggggcacacaacatgcgtgacgtaactgggtccattgcagagaaacttggtgtccaa
gctcctccagtcagaatcgacagccaagcaaaatatggcgctctagctcgtggagatggt
gccatttacttgcgttttccacacaagggttacaaggagaagatatgggatcatgcagct
ggctcaattgttgtcacagaagctggaggtatagtaacagacgcctcaggaaaagatctg
gatttctcgaaagggcgatgtcttgatgatcttgacacaggcatcgtcgccacaaataag
caactgatgccatcactcctgaaggctgtccaagaggccatcaaggagaaaaaccaggcc
ccttcacccttgtag

DBGET integrated database retrieval system