KEGG   Brachypodium distachyon: 100845033Help
Entry
100845033         CDS       T01717                                 

Definition
probable 6-phosphogluconolactonase 4, chloroplastic-like
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
bdi  Brachypodium distachyon
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:bdi01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bdi00030]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 328 aa AA seqDB search
MSVSVSAAAFSSHPPLSRRRSPPASRLPPNSHRIQLHSGPKPRRPRLLSSARAPILPTAA
MATDSAAPAASGAGSKRNLLIFDAEEDLAVSLAKYTADLSAKFAAERGAFTVVLSGGSLI
EALRNLAEPPYLETVDWSKWHVFWVDERVVPKDHEDSNYKLALDGLLAKVPIPPGQVYAI
NDALSAEGAADDYETVLKQLVKNGVLAMSTATGFPRFDVMLLGMGPDGHIASLFPGHPLV
KENQKWVTHIKDSPKPPPERITFTFPVINSSAYVAMVVTGAGKAGAVQKALSDKQASSDL
LPVEMAILQDGEFTWFTDKEAVSMLQNK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtatccgtctccgccgccgctttttcctcccacccacccctctcccgccgccgc
tcgccgccggcatctcgcctcccgcccaacagccaccgcatccagctccattccgggccc
aagccccggcgtccccgtctcctctcctccgcgcgcgcccccatcctccccaccgccgcg
atggccaccgacagcgccgcccccgccgcctccggggccgggtccaagaggaacctgctc
atcttcgacgcagaggaggacctcgcggtgtctctggccaagtacacggcagacctgtct
gcgaagttcgccgccgagaggggcgccttcaccgtcgtgctctccggcggatccctcatc
gaggccctcaggaacctggcggagccgccgtacctggagacagtcgactggagcaagtgg
cacgtgttctgggtcgacgagagggtggtgcccaaggatcacgaggatagcaactacaag
ctcgcattggatgggttgcttgccaaggtaccaattcctcctggtcaagtctatgctatc
aatgatgccttgtctgctgagggagcagcagatgactatgaaactgtattgaagcaactt
gttaagaatggtgttctagcaatgtccacagcaactgggtttcccaggtttgatgtcatg
cttctcggcatgggccctgacggccacattgcctctctcttcccgggtcaccctcttgta
aaggagaaccagaagtgggtcacccacatcaaggattctccgaagccgccaccagagaga
attacatttacatttccagtgatcaactcttctgcatatgttgccatggttgttactggg
gctgggaaagctggtgctgtgcagaaagcgctttcagacaaacaggcttcgtctgatcta
ctacctgttgagatggctatacttcaggatggagaattcacctggttcactgacaaggag
gcagtttcaatgctgcagaacaagtga

DBGET integrated database retrieval system