KEGG   Brachypodium distachyon: 100845033Help
Entry
100845033         CDS       T01717                                 

Definition
probable 6-phosphogluconolactonase 4, chloroplastic
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
bdi  Brachypodium distachyon
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100845033
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100845033
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     100845033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 328 aa AA seqDB search
MSVSVSAAAFSSHPPLSRRRSPPASRLPPNSHRIQLHSGPKPRRPRLLSSARAPILPTAA
MATDSAAPAASGAGSKRNLLIFDAEEDLAVSLAKYTADLSAKFAAERGAFTVVLSGGSLI
EALRNLAEPPYLETVDWSKWHVFWVDERVVPKDHEDSNYKLALDGLLAKVPIPPGQVYAI
NDALSAEGAADDYETVLKQLVKNGVLAMSTATGFPRFDVMLLGMGPDGHIASLFPGHPLV
KENQKWVTHIKDSPKPPPERITFTFPVINSSAYVAMVVTGAGKAGAVQKALSDKQASSDL
LPVEMAILQDGEFTWFTDKEAVSMLQNK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtatccgtctccgccgccgctttttcctcccacccacccctctcccgccgccgc
tcgccgccggcatctcgcctcccgcccaacagccaccgcatccagctccattccgggccc
aagccccggcgtccccgtctcctctcctccgcgcgcgcccccatcctccccaccgccgcg
atggccaccgacagcgccgcccccgccgcctccggggccgggtccaagaggaacctgctc
atcttcgacgcagaggaggacctcgcggtgtctctggccaagtacacggcagacctgtct
gcgaagttcgccgccgagaggggcgccttcaccgtcgtgctctccggcggatccctcatc
gaggccctcaggaacctggcggagccgccgtacctggagacagtcgactggagcaagtgg
cacgtgttctgggtcgacgagagggtggtgcccaaggatcacgaggatagcaactacaag
ctcgcattggatgggttgcttgccaaggtaccaattcctcctggtcaagtctatgctatc
aatgatgccttgtctgctgagggagcagcagatgactatgaaactgtattgaagcaactt
gttaagaatggtgttctagcaatgtccacagcaactgggtttcccaggtttgatgtcatg
cttctcggcatgggccctgacggccacattgcctctctcttcccgggtcaccctcttgta
aaggagaaccagaagtgggtcacccacatcaaggattctccgaagccgccaccagagaga
attacatttacatttccagtgatcaactcttctgcatatgttgccatggttgttactggg
gctgggaaagctggtgctgtgcagaaagcgctttcagacaaacaggcttcgtctgatcta
ctacctgttgagatggctatacttcaggatggagaattcacctggttcactgacaaggag
gcagtttcaatgctgcagaacaagtga

DBGET integrated database retrieval system