KEGG   Brachypodium distachyon: 100845033Help
Entry
100845033         CDS       T01717                                 

Definition
probable 6-phosphogluconolactonase 4, chloroplastic-like
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
bdi  Brachypodium distachyon
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100845033
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100845033
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     100845033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 328 aa AA seqDB search
MSVSVSAAAFSSHPPLSRRRSPPASRLPPNSHRIQLHSGPKPRRPRLLSSARAPILPTAA
MATDSAAPAASGAGSKRNLLIFDAEEDLAVSLAKYTADLSAKFAAERGAFTVVLSGGSLI
EALRNLAEPPYLETVDWSKWHVFWVDERVVPKDHEDSNYKLALDGLLAKVPIPPGQVYAI
NDALSAEGAADDYETVLKQLVKNGVLAMSTATGFPRFDVMLLGMGPDGHIASLFPGHPLV
KENQKWVTHIKDSPKPPPERITFTFPVINSSAYVAMVVTGAGKAGAVQKALSDKQASSDL
LPVEMAILQDGEFTWFTDKEAVSMLQNK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtatccgtctccgccgccgctttttcctcccacccacccctctcccgccgccgc
tcgccgccggcatctcgcctcccgcccaacagccaccgcatccagctccattccgggccc
aagccccggcgtccccgtctcctctcctccgcgcgcgcccccatcctccccaccgccgcg
atggccaccgacagcgccgcccccgccgcctccggggccgggtccaagaggaacctgctc
atcttcgacgcagaggaggacctcgcggtgtctctggccaagtacacggcagacctgtct
gcgaagttcgccgccgagaggggcgccttcaccgtcgtgctctccggcggatccctcatc
gaggccctcaggaacctggcggagccgccgtacctggagacagtcgactggagcaagtgg
cacgtgttctgggtcgacgagagggtggtgcccaaggatcacgaggatagcaactacaag
ctcgcattggatgggttgcttgccaaggtaccaattcctcctggtcaagtctatgctatc
aatgatgccttgtctgctgagggagcagcagatgactatgaaactgtattgaagcaactt
gttaagaatggtgttctagcaatgtccacagcaactgggtttcccaggtttgatgtcatg
cttctcggcatgggccctgacggccacattgcctctctcttcccgggtcaccctcttgta
aaggagaaccagaagtgggtcacccacatcaaggattctccgaagccgccaccagagaga
attacatttacatttccagtgatcaactcttctgcatatgttgccatggttgttactggg
gctgggaaagctggtgctgtgcagaaagcgctttcagacaaacaggcttcgtctgatcta
ctacctgttgagatggctatacttcaggatggagaattcacctggttcactgacaaggag
gcagtttcaatgctgcagaacaagtga

DBGET integrated database retrieval system