KEGG   Brachypodium distachyon: 100845163Help
Entry
100845163         CDS       T01717                                 

Definition
putative PAP-specific phosphatase, mitochondrial-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bdi  Brachypodium distachyon
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100845163
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100845163
Transfer RNA biogenesis [BR:bdi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100845163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 424 aa AA seqDB search
MPLLHLSLPPHRLLVGRRRLFAPPTPPPSRHYCIRAAAEEACSLPFAPERASYHRELAAA
AASVERACRLCVDVKKSLLSGGRKILEKNDQSPVTIADFGVQALVSFELQQLFPSIPLVA
EEDSAFLRSSNPDDNSSNVLVESISSAVVDKVNNSGSNLSHHDVLRAIDRGGMDAVSFDS
NPATYWVLDPIDGTKGFLKGDDALYVVGLALVVKGKVTAGVMGCPNWTDITIANEKEESN
AACRGSGILMVSHVGCGTWSRDLSAEIGQFTTSQDVWKRCFVDHCSVVHMARFCIPDSQT
WNMIPLSLLFSSTTDESDPKDENKILLQYACCGSLCKYLMVASGRASVFFSRARAKTQIK
AWDHAVGVVCVQEAGGQISDWSGKPLDFSADLTGRRIIYPWGGVLVTNGALHDQLVEMIS
ANYK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcctccacctctcgcttccgccgcaccgcctcctcgtcggccgccgccggctg
ttcgccccgccgacgcctcctccctcccgccactactgcataagggcggccgcggaggag
gcgtgtagcctccccttcgctccggagcgcgcttcctatcaccgggagctcgccgcggcc
gccgcctccgtcgaacgcgcctgccgcctctgcgtagacgtgaagaaatcactgctttca
ggtggaaggaagattcttgaaaagaatgatcaaagtcctgtaacaattgctgattttgga
gttcaggcccttgttagctttgagctccagcaattgtttccatcaattcctttggtggcg
gaagaggactcagcatttctaaggtcgtcaaatcctgatgataacagtagtaatgtactc
gttgagtcaatttcaagtgcagttgtggacaaagtgaataacagtggttcaaatttaagt
catcatgatgtattgagagctattgatagagggggcatggatgctgtttcctttgattca
aatcctgctacttattgggtacttgatccaattgatggcactaagggtttcttgaaagga
gacgatgctctttatgtggtgggtctggctcttgtggtgaaaggaaaggtgacagcagga
gtgatgggatgtccaaattggaccgatattaccatagccaatgagaaagaagaaagtaat
gctgcttgtcgtggaagtggcatcctaatggtgtctcatgtaggctgtggtacttggtct
agggacctgtctgctgagattgggcagttcacaacatcacaggatgtttggaagagatgc
tttgttgatcactgttcagttgtacacatggcacgcttctgcattcctgatagccaaact
tggaatatgataccgttgtctcttctcttcagctcaacgacagatgaatctgatcctaaa
gatgagaacaaaatccttctacagtatgcttgctgtggcagcctgtgcaagtacctaatg
gtagcttctgggagagcctcagtttttttcagtcgagcacgggcgaaaactcaaatcaag
gcttgggatcatgcagttggggtagtttgtgtgcaggaagcaggaggtcagatcagtgat
tggagtggaaaaccgttggatttttcagctgacctaacagggcgcagaatcatataccca
tggggcggtgttctcgtgaccaacggtgctctgcatgaccagctcgttgaaatgatctca
gcaaattacaaatag

DBGET integrated database retrieval system