KEGG   Brachypodium distachyon: 100845384Help
Entry
100845384         CDS       T01717                                 

Definition
sphingosine kinase 1-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
bdi  Brachypodium distachyon
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100845384
Enzymes [BR:bdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100845384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 497 aa AA seqDB search
MEDRHAYEKVRVNGAPAEATLSTGTGGGGGPELRWRCAGGVTAERSLSLEADVLGVEANG
KEVVVRAFVADAAAASCAAVGKRRREIRRRKDYVFEMAAGEGAAAAWGDTLRGCLDSFGR
PKRLFVFVNPFGGKKRANKIYAAEIKPLFEAAGVQITTQETKHRGHAREVASSLDLGRYD
GIVCVSGDGVLVEVVNGILQRTDWKEAVKMPIGIVPAGTGNGMAKSLLHAAGETYSVSDA
VFAIIRGHKQSLDVCAIVQGQERIFSVLSMTWGLVADIDIESEKYRWMGSARFDFYALVR
IMNLRRYCGSIHFVPAPGYEAYGEPVTQVDNIVERIEQNRESPGPGPGFSQGPSAELERS
DWRFFDGPFVAVWINNVPWAAESAMAAPEAKFSDGYMDVVIIRDCPKPDLLALLLKMSDG
SYVKSTYVTYLKVKSFRLSPGQLVENPRRGGVIDVDGEVIARGEGTYGKDQHEDLMTYGP
SIQLTVHQALATIFSPK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaagaccgccacgcatacgagaaggtccgcgtgaacggcgcgccggccgaggcgacg
ctctccaccggaaccggcggcggaggcggcccggagcttcgttggcgctgcgctggaggg
gtcacggcggagaggagcctgtcgttggaggccgacgtgctcggggtcgaggcgaacggg
aaggaggtcgtcgtcagggccttcgtggcggacgccgccgcggcgtcgtgtgccgcggtc
ggtaagaggagaagggagataaggcgcaggaaggactacgtgttcgagatggccgccggc
gagggcgcggccgcggcctggggcgacacgctacgaggctgcttggactcgttcggccgg
ccgaagaggttgttcgtcttcgtcaaccccttcggcggcaaaaagcgggcaaacaagatc
tacgccgcggaaatcaagcccctgttcgaagctgccggggtccaaatcacgacgcaagag
accaagcaccgggggcacgcccgggaggtcgcgtcttccctcgaccttggaagatacgat
gggatcgtctgcgttagtggcgatggtgtccttgtggaggtagtgaacggaattctacaa
cgaacagactggaaggaagcagtaaaaatgccgattggaatagttccagctggtacagga
aatggcatggccaaatcacttctacatgctgccggtgagacgtactcagtttcagacgcc
gtatttgccatcatcagaggtcacaagcagtccttggatgtctgcgccattgtgcaaggg
caggagagaattttcagcgtgttgtcaatgacctggggtttggtggcagatatagatatc
gaatccgagaaatacaggtggatgggaagcgcacgcttcgacttctacgctctagttcga
ataatgaacttgcgccgatattgcggaagcatccatttcgtgcctgccccaggctacgag
gcgtatggagagcccgtgacacaagtggataacattgtggaacgtatagagcagaatagg
gaatcccctggccctggccctgggttttctcaaggtccttcagctgagttagaacgctcg
gactggagattctttgatggcccgtttgtggcagtttggataaacaacgtgccatgggct
gctgagagtgccatggcagctcctgaggccaagttctcagatggctatatggatgtagtt
ataatccgagactgtccaaagcctgatcttctagctctactgctaaagatgagcgatggg
agctatgtgaaatcgacatatgttacatatctcaaggtgaaatcttttcggttatcgcca
ggccagcttgttgaaaatccgagaaggggcggtgtcattgacgtggatggtgaggtgatt
gcaagaggagaaggaacgtacggcaaagaccagcatgaagatttgatgacctatggtcct
tctattcagctgacagtgcaccaggccttggccactattttttctcccaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system