KEGG   Brachypodium distachyon: 100845394Help
Entry
100845394         CDS       T01717                                 

Definition
PAP-specific phosphatase HAL2-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bdi  Brachypodium distachyon
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100845394
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100845394
Transfer RNA biogenesis [BR:bdi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100845394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 462 aa AA seqDB search
MGSIRLSAWTAASSSPAARGFPPSDWRGRVRGRRRRAHCAPPSAPPPPSLGASSRLRVGT
QHELLWDCRGGGLGGGGRRDYAKEMEAAVRVVQVACTLCQRVQDSLLLANPAGSGSNSGG
VHSKLDRSPVTVADWGVQAIVSWLLSDFFRDESVSIVAEEDDQTLSSSDGTALLESVVAA
VNGCLVEAPKYGLRSPEKDLRASDVLQAIRKCSSAGGPKGRFWVLDPVDGTLGFVRGDQY
AIALALIEDGEVVLGVLGCPNYPMKKEWLNYHQRYYRLMSKVAPPASGSWNKGCVMYAHK
GCGQAWMQPLVHDFGMLNWHNSREIQVSSVSDPVSATFCEPVEKANSSHSFTAGLAHSVG
LRSQPLRVYSMVKYAAIARGDAEIFMKFARAGYKEKIWDHAAGVVIIQEAGGVITDAGGC
PLDFSRGVYLEGLDRGIIACSGALLHHRILEAVDASWNSSTL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcatccgcctctccgcctggacggccgcgtcctcaagccccgccgcacgaggc
ttcccgccgtcggactggcgcggacgggtgcgcgggcgccgccgccgcgcccactgcgcc
ccgccgtcggcgccaccgccgccgtctctgggcgcgagcagccgcctccgggtcgggacg
cagcacgagttgctctgggattgccgcggcggcggactcggaggagggggccgaagggat
tacgccaaggagatggaggccgcggtgcgtgtcgtgcaggtggcctgcacgctgtgccag
cgcgtgcaggactcgctcctcctcgccaaccccgccggctccggttccaactccggcggc
gtgcactccaagctcgaccgctctccggtcaccgtcgccgattggggcgtgcaagcgata
gtaagctggttactctcagatttctttcgtgatgaaagtgtgtcgattgtagcagaggaa
gatgatcagacgctatctagcagcgatggcacggctttgcttgagtctgttgtcgcggct
gtcaatggttgcctggttgaagctccaaagtatgggctgagatccccagagaaagacctc
agagcttctgatgttcttcaagctatacgaaagtgtagctctgccggaggtccgaaagga
agattttgggtgcttgatcctgtggatggcacacttggttttgtgcgtggggaccaatat
gctattgctcttgccttaattgaagacggagaagtcgtgcttggtgttcttggatgccca
aattatccaatgaagaaggaatggctcaactatcaccaacgatactacaggttgatgtct
aaggttgctccccctgcatcaggatcctggaacaagggttgtgtgatgtatgctcacaaa
ggatgtggtcaagcttggatgcaaccattggttcatgactttggtatgcttaactggcat
aactcaagggagattcaagtatcatccgtcagtgatccagtttcagccacattctgcgaa
cctgttgaaaaagccaactcaagccattccttcactgcaggacttgctcatagtgtaggc
ttaaggtcacaacctctgcgtgtgtacagcatggtgaaatatgctgcaatagctcgaggt
gatgcagaaatcttcatgaaattcgctagagctggatacaaggagaagatatgggatcat
gctgcaggggtagtcatcattcaagaggctggtggagtgatcacggatgctggaggttgc
ccgttggacttctccaggggcgtttacttggagggtttggatagaggcataatagcttgc
tctggagcattgcttcatcatagaattttagaagctgttgatgcaagttggaactcctca
acattgtga

DBGET integrated database retrieval system