KEGG   Brachypodium distachyon: 100845513Help
Entry
100845513         CDS       T01717                                 

Definition
probable histone acetyltransferase HAC-like 1-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 1661 aa AA seqDB search
MNVGQAPHLSGQMSGQAPQMNQVVSGGDGLPQHQQMQDAVALSVGNDPHFVMLRNSMREK
IFEYIGRKQSSAEWRRRLPELARRLEEILFRKFPNKTEYYSMMKAPVEPQLQFAIKTLSA
QNQQNQQNQQMSRQIASSSGYGTMIPTPGITQGVTGNSRMSYVTDNMGLPSSGAGMVPQN
ANMGSMSNGYQHLTTSVPLSSTTSSGPSTMGAVGIQRQVTHMIPTPGFNNQQNVPANPDY
SNGTGYFNGESTMTPHMQQQKQFQSNQSSHQIQQIGGHSNSGIHSSMLENSSAFGLSDGH
VNGGMGLHGSNTQVTNRSAAPEAYMNISSYGSSPRPLQQQFNQHPTQRVPTSVDMGGSGS
FYSTGTSALATANQRSRMNSMLLNNQLNMQSIQAQPQIKAEVLDQPEKVNFQSSQLSQEQ
LLRQQLTMQQHQMQPNSQFVQNQYHLNQQLPNSQHQQTMLRSNSFKQSQLNSSHSMQVSE
QGALPHTELASSQAAEPAALPNFQGQYQQRTVHGNAKGGQVFGHVSGSQNFHASASHDSQ
QLLPTNQQLDDSSNDVSYVLKGSQPEQMQQPQWQPQTMEKAPIISNSSLEKQIQDDFCQR
TMAQDEAQQPFSSDWRLSGCTVTAVGPTSAKLPTGAFEQPTGNINHLRQMRWLLLLFHAK
SCPSPVGSCKFLRCVELQDLVKHVDYCQRKDCPHKKCSKSRKLIEHYKACVDQQCPVCSN
VKKYLRLSHEQASKQKLPEPRKVAQQSTSQRIMNGVEGDIMDIDPVSVEAFDGQPSVPKR
LKMRPASPSAPEHEISRASNPHLNAGFIPQETHPELLEQNKKMAYLKREVDAKADMRPIQ
KPVKMGYGVDGNVPAARHVIPGVSNEMKPHVKQEILSIDKDTSDTLEVKNEANDLTDATA
SKSGKPKIKGVSLTELFTPEQIQAHINSLRLWVGQSKAKVEKTILLGSSENENSCQLCKV
EKLTFEPPPIYCSPCGARIKRNAPYYTVGTGDTRHFFCIPCYNESRGDTIEVEGQNFLKA
RFEKKRNDEETEEWWVQCDKCECWQHQICALFNGRRNDGGQAEYTCPNCYVKEVQRGLRM
PLPQSAVLGASDLPRTVLSDHIEERLFKRLKVERQARATSSGVSFDEVAGAEGLVVRVVS
SVDKKVEVKPRFLEIFQEDNYPTEFPYKSKAVLLFQKIEGVEVCLFGMYVQEFGAECSYP
NQRRVYLSYLDSVKYFRPEIRAASGEALRTFVYHEILIGYLEYCKQRGFTSCYIWACPPL
KGEDYILYCHPEIQKTPKSDKLREWYLAMLRKATKEEIVVELTNLYDHFFITMGECKAKV
TASRLPYFDGDYWPGAAEDMINQLRQEEDDRKLQKKGKTKKIITKRALKAAGHTDLSGNA
SKDAMLMQKLGETIYPMKEDFIMVHLQYSCHHCCILMSSGKRWVCHQCRSFYICDKCYDA
EQQREDREKHPSNSRDTHKLHPVDIVGVPEDTKDRDDILESEFFDTRQAFLSLCQGNHYQ
YDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNVCAHDIETGQGWRCEVCPDFDLRKMLDLL
VHASTCRSGSCQYPNCRKVKGLFRHGMQCKIRASGGCALCKKMWYMLQLHARACRDSGCS
VPRCRDLKEHLRRLQQQSDSRRRAAVNEMMRQRAAEVASHD
NT seq 4986 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtggggcaggcgccgcacctgtccgggcagatgtcggggcaggcgccgcagatg
aatcaggtcgtcagcggcggcgacgggctgccgcagcaccagcagatgcaggacgcggtg
gcgctcagcgtggggaacgatccccacttcgtcatgctgcgcaactcgatgcgcgagaag
atatttgagtatattggaaggaagcagtcatcagctgaatggaggcggcggctgccagaa
ctcgcaaggcggctagaggaaatattgttcagaaaatttccaaacaagactgagtactac
agtatgatgaaggcaccagttgagccacaattgcagtttgctattaagaccttgagtgct
cagaaccaacaaaatcaacaaaaccaacaaatgtcaagacagatagcatcttcctctggt
tacggtacaatgattccgacacctggtatcacacaaggtgtaactggaaactctagaatg
tcttatgtaacagacaacatgggtcttccatcatctggtgcaggcatggttcctcagaat
gccaacatgggttccatgtctaatggctaccagcatctaactaccagtgtcccactaagt
tctaccacaagtagcggcccatctacaatgggtgcagtgggtattcagcgtcaagtaact
catatgatcccaactccaggattcaataatcagcagaatgtacctgccaatcctgactat
tcaaatggaactggatatttcaatggtgagtcaactatgacaccacatatgcagcagcag
aagcaattccagagtaaccaaagtagccaccaaatccagcaaatcgggggacacagtaat
tctggaatacattcaagcatgctggagaattcttctgcatttggtttatcagatggacac
gtgaatggtggaatgggattgcatgggtcaaacacacaggtaacaaacagaagtgcagct
ccagaagcatatatgaacatatcctcttatggcagttcgcccagacctttgcagcaacag
ttcaatcagcatcctacacagagagtaccaacgtcagttgacatgggtggttctggaagt
ttttacagtactgggacttctgctttagcaaccgccaatcagagatcaagaatgaattcg
atgttgcttaacaatcaactaaacatgcaatccattcaagctcaacctcagattaaagct
gaggtcttggatcaaccagaaaaagtgaattttcagtcatctcaattgagtcaggaacaa
ctactccgccagcagcttacaatgcagcaacatcagatgcagccgaattcccagtttgtg
caaaaccaatatcatctcaaccaacagctgccaaattcacagcatcagcagactatgctg
aggagcaattcttttaaacagtctcagctgaattccagccattctatgcaagtgtcagaa
cagggtgctctgccacacacagagctggcatcttcacaagctgctgaacctgctgcactt
ccaaatttccagggtcagtaccagcaaagaactgttcacggtaatgccaaaggtgggcag
gtgtttggacatgtttctggctctcaaaatttccatgcttctgcttctcacgattctcag
caattgttgccaactaatcagcagcttgatgacagctccaatgatgtcagttacgtcctg
aaaggatcacagccagagcaaatgcagcagccccagtggcagcctcagacaatggagaag
gccccaatcattagtaattcatctcttgaaaagcaaatacaggatgacttttgtcagaga
acaatggcccaggacgaagcacaacagccattctcatccgactggcgtctttctggttgc
actgtgactgcagttggtcctacatcggcaaagctaccaactggagcctttgaacagccc
actggaaatatcaatcacctccgtcagatgaggtggttactcttgctctttcatgcgaaa
tcctgtccgtctcctgttggaagttgtaaattccttcgttgtgttgagctacaggatctt
gtgaagcatgtcgattactgtcaaagaaaagattgtccgcacaagaagtgcagtaagtca
agaaagctgattgaacattataaggcttgtgttgatcagcagtgtcctgtatgtagtaat
gtgaagaaatatttacgcctctcacatgaacaggcaagtaagcaaaaactgccagaacct
agaaaagttgctcaacagagtacgagtcaaagaattatgaatggtgtagaaggtgatata
atggacattgacccagtgtctgttgaagcctttgatggtcagccatctgttccgaaacgc
ttgaagatgcggcctgcatcacccagtgctcctgagcatgagatatctagagcctctaat
cctcatttgaatgcagggttcataccacaggaaacacatcctgagctgcttgagcagaat
aaaaagatggcatacctgaaacgggaggtggatgcaaaggctgacatgcgacctatacag
aagcctgtaaagatgggttatggtgttgatggaaatgtgcctgcagcgaggcatgtgatt
cctggtgtttcaaatgagatgaagcctcatgtgaagcaagaaatcttgtcgattgacaaa
gatacgagtgatacccttgaggttaagaatgaagcaaatgatttaacagatgccacagcg
tccaaatcaggaaaaccaaagataaaaggtgtctcattgaccgagttgttcactccagaa
caaattcaagcacatataaacagtctaaggctgtgggttgggcagagcaaggctaaagtt
gagaagactatattgctggggtcttctgaaaatgaaaattcatgccagctctgcaaagtg
gaaaaacttacttttgaacctccaccaatatactgctccccttgtggtgctcggataaag
cgaaatgcaccatactacactgttggtactggagatacacgccactttttctgtattcca
tgttacaatgagtcacgtggtgacaccattgaggttgaaggacagaattttttgaaggca
cgatttgagaaaaaaagaaatgatgaggaaactgaagaatggtgggttcaatgtgacaag
tgtgaatgctggcagcatcagatatgtgctctatttaatggcagaagaaatgatggagga
caagcagagtatacttgcccaaattgctatgttaaagaagtgcaacgtgggttgcgcatg
cctttaccacagagtgccgttcttggggcgagtgatttgccaagaactgttcttagcgat
catatcgaagagcgtctttttaaacggcttaaggtggagagacaggctcgggcaactagt
tcaggagttagttttgatgaggttgctggagccgaaggtcttgtggtcagagttgtttca
tcggtggataagaaggttgaagttaaaccacgttttttggaaatttttcaagaagacaat
tacccgacagagttcccgtacaagtccaaggctgtccttttgttccagaaaatagaaggt
gtggaggtttgcttattcggaatgtatgttcaagaatttggtgctgagtgctcttacccg
aaccaacgccgtgtttatttgtcatacctggattctgttaaatacttcagacctgagatt
agagcagcgtctggagaggccttgcgtacattcgtctaccatgaaattctgataggatat
cttgaatattgcaagcagcgtggattcacaagctgttatatatgggcttgcccacctttg
aaaggtgaagattacattttatattgccatcctgagattcagaagacccccaaatccgac
aaactgcgggaatggtacttggctatgcttcgaaaagctactaaggaggagatagttgtt
gaactcacaaatctctatgaccatttcttcattactatgggggagtgcaaggctaaagtt
acagcttctcgattgccttacttcgatggagattattggccaggagctgccgaagatatg
atcaatcaacttcgtcaagaagaagatgaccgaaagcttcagaagaagggtaagactaag
aagattattacaaaaagagctctcaaagctgctggtcacacagatctcagtgggaatgct
tcgaaggatgctatgctgatgcagaagcttggggaaaccatctacccgatgaaggaagat
ttcattatggtccatctgcaatattcttgtcatcactgttgtatccttatgtcgtctggg
aaacgctgggtttgtcatcaatgcagaagtttctacatctgtgacaagtgttacgatgca
gaacaacagcgtgaagatagggagaagcatccaagtaatagtagagacacacacaagctc
catccggttgacattgttggggtgcctgaagatacaaaggatagagacgatatcctagaa
agtgaattttttgacaccagacaggcattcctgagtctttgtcaagggaatcattaccag
tatgacacccttcgacgtgctaagcattcgtcaatgatggtgttgtatcatttacataat
ccaactgcaccagcgtttgtcactacgtgcaatgtctgtgctcatgatattgaaactggt
caaggctggcgatgtgaagtttgtccagattttgatctaaggaaaatgcttgatcttctg
gtgcatgcctcaacatgccgctcaggcagctgccaatatccgaactgccgtaaagtcaag
ggactatttcgtcatgggatgcagtgcaaaatacgtgcttcaggagggtgtgcgctgtgt
aagaaaatgtggtacatgcttcagctccatgcccgagcttgcagagattcaggatgcagt
gtgccgaggtgcagggatctcaaagagcatcttagaaggttgcagcagcagtccgattcc
aggaggagggctgctgtcaatgaaatgatgagacaacgagcagcagaggttgcttcacat
gattag

DBGET integrated database retrieval system