KEGG   Brachypodium distachyon: 100845513Help
Entry
100845513         CDS       T01717                                 

Definition
(RefSeq) probable histone acetyltransferase HAC-like 1
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100845513
Transcription factors [BR:bdi03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100845513
Mitochondrial biogenesis [BR:bdi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100845513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1706 aa AA seqDB search
MNVGQAPHLSGQMSGQAPQMNQVVSGGDGLPQHQQMQDAVALSVGNDPHFVMLRNSMREK
IFEYIGRKQSSAEWRRRLPELARRLEEILFRKFPNKTEYYSMMKAPVEPQLQFAIKTLSA
QNQQNQQNQQMSRQIASSSGYGTMIPTPGITQGVTGNSRMSYVTDNMGLPSSGAGMVPQN
ANMGNSIPGSMSNGYQHLTTSVPLSSTTSSGPSTMGAVGIQRQVTHMIPTPGFNNQQNVP
ANPDYSNGTGYFNGESTMTPHMQQQKQFQSNQSSHQIQQIGGHSNSGIHSSMLENSSAFG
LSDGHVNGGMGLHGSNTQVTNRSAAPEAYMNISSYGSSPRPLQQQFNQHPTQRVPTSVDM
GGSGSFYSTGTSALATANQRSRMNSMLLNNQLNMQSIQAQPQIKAEVLDQPEKVNFQSSQ
LSQEQLLRQQLTMQQHQMQPNSQFVQNQYHLNQQLPNSQHQQTMLRSNSFKQSQLNSSHS
MQVSEQGALPHTELASSQAAEPAALPNFQGQYQQRTVHGNAKGGQVFGHVSGSQNFHASA
SHDSQQLLPTNQQLDDSSNDVSYVLKGSQPEQMQQPQWQPQTMEKAPIISNSSLEKQIQD
DFCQRTMAQDEAQQPFSSDWRLSGCTVTAVGPTSAKLPTGAFEQPTGNINHLRQMRWLLL
LFHAKSCPSPVGSCKFLRCVELQDLVKHVDYCQRKDCPHKKCSKSRKLIEHYKACVDQQC
PVCSNVKKYLRLSHEQASKQKLPEPRKVAQQSTSQRIMNGVEGDIMDIDPVSVEAFDGQP
SVPKRLKMRPASPSAPEHEISRASNPHLNAGFIPQETHPELLEQNKKMAYLKREVDAKAD
MRPIQKPVKMGYGVDGNVPAARHVIPGVSNEMKPHVKQEILSIDKDTSDTLEVKNEANDL
TDATASKSGKPKIKGVSLTELFTPEQIQAHINSLRLWVGQSKAKVEKTILLGSSENENSC
QLCKVEKLTFEPPPIYCSPCGARIKRNAPYYTVGTGDTRHFFCIPCYNESRGDTIEVEGQ
NFLKARFEKKRNDEETEEWWVQCDKCECWQHQICALFNGRRNDGGQAEYTCPNCYVKEVQ
RGLRMPLPQSAVLGASDLPRTVLSDHIEERLFKRLKVERQARATSSGVSFDEVAGAEGLV
VRVVSSVDKKVEVKPRFLEIFQEDNYPTEFPYKSKAVLLFQKIEGVEVCLFGMYVQEFGA
ECSYPNQRRVYLSYLDSVKYFRPEIRAASGEALRTFVYHEILIGYLEYCKQRGFTSCYIW
ACPPLKGEDYILYCHPEIQKTPKSDKLREWYLAMLRKATKEEIVVELTNLYDHFFITMGE
CKAKVTASRLPYFDGDYWPGAAEDMINQLRQEEDDRKLQKKGKTKKIITKRALKAAGHTD
LSGNASKDAMLMQKLGETIYPMKEDFIMVHLQYSCHHCCILMSSGKRWVCHQCRSFYICD
KCYDAEQQREDREKHPSNSRDTHKLHPVDIVGVPEDTKDRDDILESEFFDTRQAFLSLCQ
GNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNVCAHDIETGQGWRCEVCPDFDVCN
SCYQKGAVTHAHKLTNHPSAADRDAQNKEARQIRVQQLRKMLDLLVHASTCRSGSCQYPN
CRKVKGLFRHGMQCKIRASGGCALCKKMWYMLQLHARACRDSGCSVPRCRDLKEHLRRLQ
QQSDSRRRAAVNEMMRQRAAEVASHD
NT seq 5121 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtggggcaggcgccgcacctgtccgggcagatgtcggggcaggcgccgcagatg
aatcaggtcgtcagcggcggcgacgggctgccgcagcaccagcagatgcaggacgcggtg
gcgctcagcgtggggaacgatccccacttcgtcatgctgcgcaactcgatgcgcgagaag
atatttgagtatattggaaggaagcagtcatcagctgaatggaggcggcggctgccagaa
ctcgcaaggcggctagaggaaatattgttcagaaaatttccaaacaagactgagtactac
agtatgatgaaggcaccagttgagccacaattgcagtttgctattaagaccttgagtgct
cagaaccaacaaaatcaacaaaaccaacaaatgtcaagacagatagcatcttcctctggt
tacggtacaatgattccgacacctggtatcacacaaggtgtaactggaaactctagaatg
tcttatgtaacagacaacatgggtcttccatcatctggtgcaggcatggttcctcagaat
gccaacatgggtaactcgatcccaggttccatgtctaatggctaccagcatctaactacc
agtgtcccactaagttctaccacaagtagcggcccatctacaatgggtgcagtgggtatt
cagcgtcaagtaactcatatgatcccaactccaggattcaataatcagcagaatgtacct
gccaatcctgactattcaaatggaactggatatttcaatggtgagtcaactatgacacca
catatgcagcagcagaagcaattccagagtaaccaaagtagccaccaaatccagcaaatc
gggggacacagtaattctggaatacattcaagcatgctggagaattcttctgcatttggt
ttatcagatggacacgtgaatggtggaatgggattgcatgggtcaaacacacaggtaaca
aacagaagtgcagctccagaagcatatatgaacatatcctcttatggcagttcgcccaga
cctttgcagcaacagttcaatcagcatcctacacagagagtaccaacgtcagttgacatg
ggtggttctggaagtttttacagtactgggacttctgctttagcaaccgccaatcagaga
tcaagaatgaattcgatgttgcttaacaatcaactaaacatgcaatccattcaagctcaa
cctcagattaaagctgaggtcttggatcaaccagaaaaagtgaattttcagtcatctcaa
ttgagtcaggaacaactactccgccagcagcttacaatgcagcaacatcagatgcagccg
aattcccagtttgtgcaaaaccaatatcatctcaaccaacagctgccaaattcacagcat
cagcagactatgctgaggagcaattcttttaaacagtctcagctgaattccagccattct
atgcaagtgtcagaacagggtgctctgccacacacagagctggcatcttcacaagctgct
gaacctgctgcacttccaaatttccagggtcagtaccagcaaagaactgttcacggtaat
gccaaaggtgggcaggtgtttggacatgtttctggctctcaaaatttccatgcttctgct
tctcacgattctcagcaattgttgccaactaatcagcagcttgatgacagctccaatgat
gtcagttacgtcctgaaaggatcacagccagagcaaatgcagcagccccagtggcagcct
cagacaatggagaaggccccaatcattagtaattcatctcttgaaaagcaaatacaggat
gacttttgtcagagaacaatggcccaggacgaagcacaacagccattctcatccgactgg
cgtctttctggttgcactgtgactgcagttggtcctacatcggcaaagctaccaactgga
gcctttgaacagcccactggaaatatcaatcacctccgtcagatgaggtggttactcttg
ctctttcatgcgaaatcctgtccgtctcctgttggaagttgtaaattccttcgttgtgtt
gagctacaggatcttgtgaagcatgtcgattactgtcaaagaaaagattgtccgcacaag
aagtgcagtaagtcaagaaagctgattgaacattataaggcttgtgttgatcagcagtgt
cctgtatgtagtaatgtgaagaaatatttacgcctctcacatgaacaggcaagtaagcaa
aaactgccagaacctagaaaagttgctcaacagagtacgagtcaaagaattatgaatggt
gtagaaggtgatataatggacattgacccagtgtctgttgaagcctttgatggtcagcca
tctgttccgaaacgcttgaagatgcggcctgcatcacccagtgctcctgagcatgagata
tctagagcctctaatcctcatttgaatgcagggttcataccacaggaaacacatcctgag
ctgcttgagcagaataaaaagatggcatacctgaaacgggaggtggatgcaaaggctgac
atgcgacctatacagaagcctgtaaagatgggttatggtgttgatggaaatgtgcctgca
gcgaggcatgtgattcctggtgtttcaaatgagatgaagcctcatgtgaagcaagaaatc
ttgtcgattgacaaagatacgagtgatacccttgaggttaagaatgaagcaaatgattta
acagatgccacagcgtccaaatcaggaaaaccaaagataaaaggtgtctcattgaccgag
ttgttcactccagaacaaattcaagcacatataaacagtctaaggctgtgggttgggcag
agcaaggctaaagttgagaagactatattgctggggtcttctgaaaatgaaaattcatgc
cagctctgcaaagtggaaaaacttacttttgaacctccaccaatatactgctccccttgt
ggtgctcggataaagcgaaatgcaccatactacactgttggtactggagatacacgccac
tttttctgtattccatgttacaatgagtcacgtggtgacaccattgaggttgaaggacag
aattttttgaaggcacgatttgagaaaaaaagaaatgatgaggaaactgaagaatggtgg
gttcaatgtgacaagtgtgaatgctggcagcatcagatatgtgctctatttaatggcaga
agaaatgatggaggacaagcagagtatacttgcccaaattgctatgttaaagaagtgcaa
cgtgggttgcgcatgcctttaccacagagtgccgttcttggggcgagtgatttgccaaga
actgttcttagcgatcatatcgaagagcgtctttttaaacggcttaaggtggagagacag
gctcgggcaactagttcaggagttagttttgatgaggttgctggagccgaaggtcttgtg
gtcagagttgtttcatcggtggataagaaggttgaagttaaaccacgttttttggaaatt
tttcaagaagacaattacccgacagagttcccgtacaagtccaaggctgtccttttgttc
cagaaaatagaaggtgtggaggtttgcttattcggaatgtatgttcaagaatttggtgct
gagtgctcttacccgaaccaacgccgtgtttatttgtcatacctggattctgttaaatac
ttcagacctgagattagagcagcgtctggagaggccttgcgtacattcgtctaccatgaa
attctgataggatatcttgaatattgcaagcagcgtggattcacaagctgttatatatgg
gcttgcccacctttgaaaggtgaagattacattttatattgccatcctgagattcagaag
acccccaaatccgacaaactgcgggaatggtacttggctatgcttcgaaaagctactaag
gaggagatagttgttgaactcacaaatctctatgaccatttcttcattactatgggggag
tgcaaggctaaagttacagcttctcgattgccttacttcgatggagattattggccagga
gctgccgaagatatgatcaatcaacttcgtcaagaagaagatgaccgaaagcttcagaag
aagggtaagactaagaagattattacaaaaagagctctcaaagctgctggtcacacagat
ctcagtgggaatgcttcgaaggatgctatgctgatgcagaagcttggggaaaccatctac
ccgatgaaggaagatttcattatggtccatctgcaatattcttgtcatcactgttgtatc
cttatgtcgtctgggaaacgctgggtttgtcatcaatgcagaagtttctacatctgtgac
aagtgttacgatgcagaacaacagcgtgaagatagggagaagcatccaagtaatagtaga
gacacacacaagctccatccggttgacattgttggggtgcctgaagatacaaaggataga
gacgatatcctagaaagtgaattttttgacaccagacaggcattcctgagtctttgtcaa
gggaatcattaccagtatgacacccttcgacgtgctaagcattcgtcaatgatggtgttg
tatcatttacataatccaactgcaccagcgtttgtcactacgtgcaatgtctgtgctcat
gatattgaaactggtcaaggctggcgatgtgaagtttgtccagattttgatgtgtgcaat
agctgttaccaaaaaggagcagtcactcatgctcacaaattgacgaaccatccatcagct
gcggaccgtgatgcccaaaataaggaagcgcggcaaatacgtgttcagcagctaaggaaa
atgcttgatcttctggtgcatgcctcaacatgccgctcaggcagctgccaatatccgaac
tgccgtaaagtcaagggactatttcgtcatgggatgcagtgcaaaatacgtgcttcagga
gggtgtgcgctgtgtaagaaaatgtggtacatgcttcagctccatgcccgagcttgcaga
gattcaggatgcagtgtgccgaggtgcagggatctcaaagagcatcttagaaggttgcag
cagcagtccgattccaggaggagggctgctgtcaatgaaatgatgagacaacgagcagca
gaggttgcttcacatgattag

DBGET integrated database retrieval system