KEGG   Brachypodium distachyon: 100845585Help
Entry
100845585         CDS       T01717                                 

Definition
probable pectinesterase 53-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bdi  Brachypodium distachyon
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bdi00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bdi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 389 aa AA seqDB search
MSAPRARLLACIGIAVATALAVVLPDGVAGHTRGVRPGEVAKNQPPFPENATRAEELERL
FLRWVRYVGGLQHTTFRHAPLARVFPSYSLVVDKNPSSGDFTSIQAAVDSLPPINLVRVV
IKVNAGTYTEKVNISPMRAFITLEGAGADRTVVQWGDTADTPAGPRGRPLGTYGSASFAV
NAQYFLARNITFKNTSPVPKAGASGKQAVALRVSADNAAFVGCKFLGAQDTLYDHTGRHY
YKDCYIEGSIDFIFGNALSLYEGCHVHAIARDYGALTAQNRQSMLEDTGFSFVNCRVTGS
GALYLGRAWGTFSRVVFAYTYMDDIIIPRGWYNWGDPSRELTVFYGQYKCTGPGASYSGR
VSWSRELTDEEAKPFISLSFIDGTEWVRL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgccacgcgcccggctcctcgcctgcattggcattgccgtggccacggcgctc
gccgtcgtgctgccagacggcgtggcgggacacacgcggggcgtgcggccgggggaggtg
gcgaagaaccagccgccgttcccggagaacgcgacgcgggcggaggagctggagcggctc
ttcttgcggtgggtgcgctacgtcggcggcctccagcacaccacgttccggcacgcgccg
ctcgcccgcgtgttcccttcctactcgctcgtcgtcgacaagaacccttcgtccggcgac
ttcacgtccatccaggccgccgtcgactctctcccgcccatcaacctcgtccgcgtcgtc
atcaaggtcaacgccggcacctacacggagaaggtgaacatatcgccgatgcgcgccttc
atcaccctggagggcgccggcgccgacaggacggtcgtgcagtggggcgacaccgccgat
acgccggccgggccgaggggccgccccctcggcacgtacggctccgcgtcgttcgccgtg
aacgcgcagtacttcctcgccaggaacatcactttcaagaacacgtcgccggtgccgaag
gcgggggcgtcggggaagcaggcggtggctctgcgggtgtcggcggacaacgcggcgttc
gtcgggtgcaagttcctgggcgcgcaggacacgctctacgatcacacgggacggcactac
tacaaggactgctacatcgaaggctccattgacttcatcttcggcaatgcgctctcgctc
tacgagggttgccacgtgcacgcgatcgcgcgggactacggcgcgctgacggcgcagaac
cggcagagcatgctggaggacacggggttctccttcgtcaactgccgggtgacggggtcc
ggagcgctctacctcggccgcgcctggggcaccttctcccgcgtcgtcttcgcctacact
tacatggacgacatcatcatcccccgtggctggtacaactggggcgaccccagccgcgag
ctgacggtgttctacgggcagtacaagtgcacgggtcccggcgcgagctactccggcagg
gtgtcgtggtcgcgcgagctcaccgacgaggaggccaagcccttcatctcgctcagcttc
atcgacggcacggagtgggtcagattgtga

DBGET integrated database retrieval system