KEGG   Brachypodium distachyon: 100845692Help
Entry
100845692         CDS       T01717                                 

Definition
dihydroflavonol-4-reductase-like
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
bdi  Brachypodium distachyon
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:bdi00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 354 aa AA seqDB search
MGGGKAGPVVVTGASGFVGSWLVMKLLQAGYTVRATVRNPSDVGKTKPLRELPGAKERLS
IWRADLSEEGSFDEAISGCTGVFHVATPMDFDSKDPENEVIKPTVEGMLSIMRACKEAGT
VKRVVFTSSAGTVNVEERQRPAYDHDNWTDLDFCRRVKMTGWMYFVSKSLAEKAAMEYAR
EKELHLISVIPTLVVGPFISAGMPPSMVTALALITGNEAHYSILKQVQLVHLDDLCDAMV
YLFEHPDARGRYICSSHEDTIHGLARMLRQRFPEYGIPEKFAGIDDDIEPVHFSSKKLLD
LGFRFRYSPEDMFDAAVRTCREKGLIPVGDRPAPAAGKTGDILVEEGQAIGAET
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggcgggggtaaagcagggccggtggtggtgacgggggcgtcaggtttcgtagggtca
tggctggtcatgaagctcctccaggcagggtacaccgtccgggccaccgtccgcaaccca
tctgatgttgggaagacgaagcctttacgggagcttcccggagcgaaagagcggctgtcc
atctggagagccgacctgagcgaggaaggcagcttcgacgaggccatctccgggtgcacc
ggcgtcttccacgtcgccacgcccatggacttcgattccaaagaccccgagaacgaggtg
atcaagcccacggtggaagggatgctgagcatcatgagagcctgcaaggaggccggcacc
gtaaaacgcgtcgtcttcacctcctccgccgggacggtcaacgtcgaggagaggcagagg
ccagcctacgaccacgacaactggaccgacctcgacttctgccgccgcgtcaagatgacc
ggatggatgtacttcgtgtccaagtccttggcggagaaggcggccatggagtacgcgagg
gagaaggagctgcacctgatcagcgtcatcccgacgctcgtcgtcggcccattcatcagc
gccggcatgccgcccagcatggtcaccgccctggcactcatcacagggaacgaagcccac
tactcgatcctgaagcaggtgcagctggttcacctggacgacctctgcgacgccatggta
tacctcttcgagcacccggacgcccgtggccgatacatctgctcctcccatgaggacacc
atccatggcctggcgaggatgctccggcagaggttccccgagtacggcatcccggagaag
tttgcggggatcgacgacgacatcgagccggtccacttctcgtccaagaagctcctcgac
ctcgggttcaggttcaggtactccccggaggacatgttcgacgccgccgttcggacgtgc
agggagaagggcctgatcccggttggagacaggccggcgcctgcagctggtaagacgggg
gatattcttgtggaggaaggtcaggcgattggtgccgagacataa

DBGET integrated database retrieval system