KEGG   Brachypodium distachyon: 100845692Help
Entry
100845692         CDS       T01717                                 

Definition
(RefSeq) dihydroflavonol 4-reductase isoform X2
  KO
K13082  bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
bdi  Brachypodium distachyon
Pathway
bdi00941  Flavonoid biosynthesis
bdi01100  Metabolic pathways
bdi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100845692
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     100845692
    1.1.1.234  flavanone 4-reductase
     100845692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NAD_binding_4 NmrA KR adh_short Polysacc_synt_2 DUF1731 RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 100845692
NCBI-ProteinID: XP_003569417
UniProt: I1HPR1
Position
2
AA seq 361 aa AA seqDB search
MKQEGREMGGGKAGPVVVTGASGFVGSWLVMKLLQAGYTVRATVRNPSDVGKTKPLRELP
GAKERLSIWRADLSEEGSFDEAISGCTGVFHVATPMDFDSKDPENEVIKPTVEGMLSIMR
ACKEAGTVKRVVFTSSAGTVNVEERQRPAYDHDNWTDLDFCRRVKMTGWMYFVSKSLAEK
AAMEYAREKELHLISVIPTLVVGPFISAGMPPSMVTALALITGNEAHYSILKQVQLVHLD
DLCDAMVYLFEHPDARGRYICSSHEDTIHGLARMLRQRFPEYGIPEKFAGIDDDIEPVHF
SSKKLLDLGFRFRYSPEDMFDAAVRTCREKGLIPVGDRPAPAAGKTGDILVEEGQAIGAE
T
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggaggggcgtgagatgggcgggggtaaagcagggccggtggtggtgacgggg
gcgtcaggtttcgtagggtcatggctggtcatgaagctcctccaggcagggtacaccgtc
cgggccaccgtccgcaacccatctgatgttgggaagacgaagcctttacgggagcttccc
ggagcgaaagagcggctgtccatctggagagccgacctgagcgaggaaggcagcttcgac
gaggccatctccgggtgcaccggcgtcttccacgtcgccacgcccatggacttcgattcc
aaagaccccgagaacgaggtgatcaagcccacggtggaagggatgctgagcatcatgaga
gcctgcaaggaggccggcaccgtaaaacgcgtcgtcttcacctcctccgccgggacggtc
aacgtcgaggagaggcagaggccagcctacgaccacgacaactggaccgacctcgacttc
tgccgccgcgtcaagatgaccggatggatgtacttcgtgtccaagtccttggcggagaag
gcggccatggagtacgcgagggagaaggagctgcacctgatcagcgtcatcccgacgctc
gtcgtcggcccattcatcagcgccggcatgccgcccagcatggtcaccgccctggcactc
atcacagggaacgaagcccactactcgatcctgaagcaggtgcagctggttcacctggac
gacctctgcgacgccatggtatacctcttcgagcacccggacgcccgtggccgatacatc
tgctcctcccatgaggacaccatccatggcctggcgaggatgctccggcagaggttcccc
gagtacggcatcccggagaagtttgcggggatcgacgacgacatcgagccggtccacttc
tcgtccaagaagctcctcgacctcgggttcaggttcaggtactccccggaggacatgttc
gacgccgccgttcggacgtgcagggagaagggcctgatcccggttggagacaggccggcg
cctgcagctggtaagacgggggatattcttgtggaggaaggtcaggcgattggtgccgag
acataa

DBGET integrated database retrieval system