KEGG   Brachypodium distachyon: 100845892Help
Entry
100845892         CDS       T01717                                 

Definition
serine/threonine-protein phosphatase PP1 isozyme 9-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
bdi  Brachypodium distachyon
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100845892
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100845892
Protein phosphatases and associated proteins [BR:bdi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100845892
Transcription machinery [BR:bdi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100845892
Messenger RNA biogenesis [BR:bdi03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100845892
Spliceosome [BR:bdi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100845892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 341 aa AA seqDB search
MRVECFTSQVGCGDARKTEPNPARDLSACLPTHGHTPPQRGRGHGGSDRGGRQVPLAEAE
IQQLRVDTKRVLLSKHNLVRIHAPVKICRDIHGQFVDLLRLCDLGGYPPTSTFVFLRDHV
DRGKQSLXTICLLLAYKIRYPGQGFPVXAKINRVYGFYDECKRRFNVRQCKIFSDYFNCL
PIAALIDDKILCMHGGLSPELNDLDKIKDIERPAEIPDYGLLCDLLWSDPSPDGEXWGET
DKGVSCTFGVDMLVQFLEKNDLDLICXAHQVVEDGYKFFAQRRLVTIFSAPKYCGEFDNV
GALLSIDENLLCSFQILKPMERDTPRVRRLIPNKPARGESS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcgagtgttttacttcccaagtcgggtgcggtgacgccagaaaaactgagccc
aacccagcaagagacctcagtgcctgcctccccacacacggccacaccccaccccagagg
ggacgcggccatggagggtccgaccgcggcgggcggcaggtgccgctggcggaggcggag
atccagcagctccgcgtcgacaccaagcgggtgctcctctccaaacacaacctcgtacgc
atccacgcccccgtcaagatctgccgcgatatccatggtcagtttgttgatcttttgagg
ttgtgtgatttgggtggttatcctccaacttcaacttttgtattcctcagagaccacgta
gatagaggcaaacagagtttgngaactatatgcttgctgctggcatacaaaataaggtac
cctggacaaggttttcctgttnatgcaaaaatcaacagagtttatggtttctatgatgaa
tgcaagaggaggttcaatgtacgacagtgtaagatattctctgattatttcaactgcctg
cctattgcagcactcattgacgacaagatactgtgcatgcatggtggcctgtcacctgaa
ctgaatgatctggacaaaataaaggatattgagagaccagctgagattcctgattatggt
ctcctctgtgatttgctttggtctgatcctagtcccgatggagaanggtggggggagact
gacaaaggggtttcatgtacgtttggcgtggatatgcttgtacagtttttggagaagaac
gatcttgaccttatatgctgagcacatcaggtggtagaagatggttacaagttcttcgcc
cagcggagattagtgacaatcttctcagctccaaaatattgtggggaattcgataatgta
ggtgctctgttgagcatagatgaaaacctattgtgttcatttcaaatcttgaagccaatg
gaaagagacacaccacgtgtaaggagattaattccaaataagccagcacgtggggaaagc
tcctga

DBGET integrated database retrieval system