KEGG   Brachypodium distachyon: 100845947Help
Entry
100845947         CDS       T01717                                 

Definition
(RefSeq) DNA repair protein XRCC4
  KO
K10886  
DNA-repair protein XRCC4
Organism
bdi  Brachypodium distachyon
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    100845947
DNA repair and recombination proteins [BR:bdi03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     100845947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 351 aa AA seqDB search
MFVFCFEKMATKNVSGSPRQLGLNSRASMLCIKPKNTQHPSRHTKRSTQPSPAHGYSFRR
HCSSRRLLTLFRTAAMATPAAAPRHSCAKLSVAVEDPKAAGGGAIFVKATWLPTRFSLAV
TDGAGAWVADASEAEVRLRAEQWDQPVSDYLSLAERYLAFQQPSSTYSFHDAGKGNRRLS
WTFERQGTKLEWRWKLQPAPQTQQTIAEVLDFLMDANIRLSEEVVRKTQSFDKLKEEADK
CLQQSERFNNEKAEFEEATFTKFVAVINSKKAKLRQLKDKFSALESSDKAPKEDEENSTD
RTEPFEEGSDKDPSINDEPSETGSGNLHSSSSPEKTAATSRGRRGRKRTRK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtttgttttttgttttgagaaaatggccaccaaaaatgtgagcggcagtccgagacaa
ttgggcctgaattctagggcctccatgttgtgcatcaagcccaagaacacacaacatcca
tcgaggcacaccaagcggagtacccagcccagcccagcccacggttactccttccgccgc
cactgctcgtcgcgtcgcctgttgactctctttcgcacggcggcgatggcaacacccgcg
gccgcgccgaggcacagctgcgccaagctctccgtggccgtggaggaccccaaggcggcg
ggcggaggcgccatattcgtgaaggccacgtggctccccacccgcttctccctcgccgtc
accgacggcgccggcgcgtgggtcgccgacgcctccgaagccgaggtgcgcctccgtgcc
gagcagtgggaccagccagtctccgactacctctccctcgccgagcgctatcttgccttc
caacagccctcctccacctactccttccacgacgccggcaagggcaatcgcaggttatca
tggacatttgaaaggcaaggtaccaaattggaatggcgttggaaactgcagcctgcaccc
cagacacaacagactatagctgaggtcttggattttcttatggatgcaaatatacgcttg
agtgaagaagttgtcaggaaaacacaatcatttgataagttgaaagaagaagctgataag
tgcttgcaacaaagtgagaggtttaacaatgagaaagctgagtttgaggaagccaccttt
acaaagtttgtggctgttataaattcgaagaaggccaagctcagacagctgaaggataaa
ttctcggcacttgaatcttctgacaaagctccgaaggaggacgaggagaactcgactgac
aggacagagcccttcgaggaaggaagtgacaaggatccaagcataaacgatgaaccctcg
gagacaggcagcggcaatctccatagctctagctctcctgagaaaaccgctgccacttcc
cgaggtaggagaggacgcaagaggacgagaaaataa

DBGET integrated database retrieval system