KEGG   Brachypodium distachyon: 100845980Help
Entry
100845980         CDS       T01717                                 

Definition
uricase-like
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
bdi  Brachypodium distachyon
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100845980
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100845980
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     100845980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 307 aa AA seqDB search
MAERFDLQSRHGKSRVRVSRVWRRPAAAGGHLFVEWSVAVSVVSDCLPSYTSDDNSAIVA
TDSIKNTVYVKAKECTEVVSMEEFAVILGRHFTSLYPQVSEASVSIVERPWERVVVDGKP
HSHGFKLGAEKHSTEVTVKKSGSLLINSGILGYSLLKTTQSGFEGFVRDRYTLLPETRER
IVATEVTAWWRYPFEHISQLPSKPFCFTQRYQDVKKVLADTFFGPPDVGVYSPSVQNTLY
LMAKEVLTRFPDISSVQLRMPNLHFLPVNLSGKENPGLVKFADDVYMPTDEPHGTIEATL
SRANSKL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgcttcgacctccagagcaggcacggcaagtcccgcgtccgcgtgtcccgc
gtgtggcgccgccccgccgcggccggcggccacctcttcgtcgagtggagtgtcgccgtg
agcgtcgtctccgactgcctcccctcctacacctccgacgacaactccgccatcgtcgcc
accgattcaatcaagaacaccgtgtatgtgaaggccaaggagtgcacggaggttgtctcc
atggaggaattcgcggttatccttggaaggcatttcacctccttgtaccctcaggtctca
gaggcttcggtgtcaatcgtggagcgcccatgggagcgtgtggttgtcgatgggaaacct
cattcacatgggttcaaacttggtgctgaaaagcacagcacagaggtcaccgtgaagaag
tctggaagcctgcttataaattctgggatactagggtactcactgttaaagaccactcag
tctggatttgaaggattcgtgagggaccgctacacacttcttccagaaacaagagaaaga
attgtagcaacagaagtaactgcttggtggaggtatccattcgaacatatttcccagctc
ccatcaaagccattttgcttcacacaaagataccaggatgtaaagaaagttctcgcagac
acattctttggtcctcctgacgttggagtgtatagtccatcggtgcagaatacattatac
ctcatggctaaagaagttcttaccaggttcccagacatatcatctgttcagcttaggatg
ccgaacctccactttctacctgtgaacttatcaggcaaagaaaatccaggattggtgaag
tttgctgatgatgtgtacatgcccactgatgaaccacatggaaccattgaagcaacgttg
agccgtgccaactcaaagttgtaa

DBGET integrated database retrieval system