KEGG   Brachypodium distachyon: 100846031Help
Entry
100846031         CDS       T01717                                 

Definition
histone H2B.2-like
Orthology
K11252  
histone H2B
Organism
bdi  Brachypodium distachyon
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 154 aa AA seqDB search
MAPKAEKKPAAKKPVEEEPAAEKAEKAPAGKKPKAEKRLPAGKTAAAKEGGEGKKGKKKA
KKSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAGESAKLARYNKKPTIT
SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaaggcggagaagaagccggcggcgaagaagcccgtggaggaggagcccgcg
gcggagaaggccgagaaggcgcccgccgggaagaagcccaaggcggagaagcggctgccg
gcggggaagacggcggcggctaaggagggaggcgaggggaagaagggcaagaagaaggca
aagaagtccgtggagacgtacaagatctacatcttcaaggtgctcaagcaggtccacccc
gacatcggcatctcctccaaggccatgtccatcatgaactccttcatcaacgacatcttc
gagaaactcgctggggagtcggccaagctcgcccgctacaacaagaagcccaccatcacc
tccagggagatccagacttcggttcgcctcgtcctccccggcgagctcgccaagcacgcc
gtctctgaaggcaccaaggccgtcacaaagttcacctcttcttag

DBGET integrated database retrieval system