KEGG   Brachypodium distachyon: 100846057Help
Entry
100846057         CDS       T01717                                 

Definition
histone-lysine N-methyltransferase EZ1-like
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100846057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 914 aa AA seqDB search
MSLAFYRSFEDWVALQADSRLLELSTLVTYNHKAMSDEEGSMASRDVLLVIDSLKEKVTA
DRFTSIKNRIKENTVKLSTFTQSTCNFSKNWQRNTSNSTDLVSDLLTTRQDDALSSVHSL
DVYPNEKDGDSSEEESSYAMSTASAKNVAHPIKLPELPRLPPYTTWTFLDRNQRMTEDQS
VLGRRRIYYDANCGEALIASDSEDEAVEDEEEKKEFKGSEDYLIRMTIQECGMSDTVLET
LAQCFDRAAGDIKARYEILNGEKTELHLKNVSELNAKVEDAYRDKDLDAALDSYDNLFCR
RCLVFDCKLHLCSQDLVFPTEKQQAWNIGDDGIPCGIHCYKLAVKPDATTTIDSHMLIDV
DEPTHSSDNTRNQFGSDKNKQGFSGRKDKSQQSESTSTPRVASESSDSELHPVSNKSLQH
SPSPSKVKNSPKGGIKKNTNKRIAERILMSVKKGQREMVSSDSNSGGFLWPRDMKLRSDT
RIGHKDSVATSQYNSPNTRNSQKRDASGIEKNSDLVEAHNNSTEEANNKHSATYDHDSSR
KDFVDEQEHNARSWKVIEQGLLVKGLEIFGRNSCLIARNLLSGMKTCRDVFQYMNYIENC
SASGALSGVDSLVKGYMKGNELHVRSRFFRRRGRVRRLKYTWKSAGYPFIRKRITEKKDQ
PCRQYNPCGCQSACGKQCPCLTNGTCCEKYCGCPKMCKNRFRGCHCAKSQCRSRQCPCFA
ADRECDPDVCRNCWVGCGDGSLGVPNQRGDNYECRNMKLLLKQQQRVLLGRSDISGWGAF
LKNSVGKHEYLGEYTGELISHKEADKRGKIYDIENSSFLFNLNNEYVLDAFRMGDKLKFA
NHSPNPNCYAKVIMVAGDHRVGIFAKERIGAGEELFYDYRYEADRAPAWARKPDAPGAKD
MAQPSSGRAKKVAH
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttgcattttacaggtcatttgaagattgggtcgcacttcaggccgattcaaga
ttgctagagctatccacgttggttacttacaatcataaggctatgtcagatgaagaagga
agtatggcctcccgagatgttttattggttattgattcattaaaggagaaagttacagca
gaccgttttacttccattaagaataggataaaggagaacacggttaagctcagcaccttt
acgcagagcacttgcaatttttcaaaaaattggcaaagaaatacatcaaatagtactgat
ttagtctcagatctgctgacaactaggcaagatgatgcactttcttctgtgcatagtctt
gatgtataccctaatgagaaagacggtgacagttctgaagaagaaagttcttatgccatg
tcaactgctagcgcaaagaatgtcgctcacccgattaaactaccagaactgccaagactt
ccgccctatacaacatggacatttttggacaggaaccaaaggatgacggaagaccaatcc
gtacttggtcgacgaaggatttactatgatgcaaattgcggtgaagctttaattgccagc
gatagtgaagatgaagctgttgaggatgaagaggagaaaaaggagttcaaaggttctgaa
gattatcttatccggatgaccattcaagagtgtggcatgtctgacacggtgctggaaacc
ctagctcaatgttttgatagggctgctggtgatataaaggccagatatgagatcctaaat
ggggagaaaactgagcttcatcttaaaaatgtgtctgaacttaatgccaaagtggaagat
gcgtaccgtgataaagatttggatgcagcattggattcctatgacaatctcttctgtcgg
cgatgtctagtttttgattgcaaactacatctgtgctcccaagatttagttttccctaca
gaaaagcaacaagcttggaacatcggggatgatggtataccatgtggtattcattgttat
aaactggccgtgaaaccagatgctactaccacaattgattctcacatgcttattgacgtt
gatgagccaactcactcatcagataatacaaggaaccagtttggctcagataagaacaaa
cagggttttagtggaaggaaagacaaatctcaacaaagtgaaagcacttcaactccaagg
gttgcctcagaaagcagtgattcagaactacatccagtgagcaataaatccctgcaacac
tctccttctccctcaaaagtaaaaaatagcccaaaaggtggaatcaagaaaaatactaat
aaaagaatagctgagcggattcttatgagtgtgaaaaaagggcaaagggaaatggtgtca
tcggactctaattctggtggattcctttggccaagagacatgaagcttagatctgataca
cgaattggacacaaggattcagttgcaacctcacaatataattctccaaacacacgaaat
tctcagaagagggatgcgtctggaattgagaagaactcagatttagtggaagctcataat
aattcgacagaggaagcaaataacaaacattcagcaacctatgatcatgatagttctagg
aaagattttgttgatgagcaagaacataacgctagatcctggaaagtaattgagcaaggg
cttctagtgaaaggtctggagatttttggaaggaacagttgtttaattgctcggaacctt
cttagtggaatgaaaacatgcagagatgtttttcagtatatgaattatattgaaaactgc
agcgcatctggtgctcttagtggtgttgattctcttgttaaaggatatatgaagggaaat
gagttgcacgtgagatcacggttttttagaaggcgtggaagagttcgtcgtttgaagtac
acctggaaatctgcaggctacccttttataaggaaaaggattactgaaaaaaaggatcaa
ccttgtcggcaatataatccctgtggttgtcaatcagcatgtgggaaacagtgcccatgt
ctcacaaatggaacatgctgtgagaaatactgtgggtgtccgaagatgtgcaagaatcgt
tttcgaggttgtcattgtgcaaagagccagtgtcgcagtcgccaatgtccatgctttgct
gctgacagggaatgtgatcctgatgtgtgcagaaactgctgggtagggtgtggtgatggt
tcattgggagttcccaaccaaagaggtgataactatgaatgccggaacatgaaactgctt
cttaaacagcaacaaagggtcttacttgggagatctgatatttctggttggggagcgttt
ctcaagaatagtgttggcaaacatgaatatcttggtgagtacactggggagcttatctcc
cataaggaagcggacaagcgtggaaaaatatatgacattgagaactcatcgttccttttc
aacttgaataatgagtatgttcttgatgctttcagaatgggtgacaagttgaagtttgcc
aaccattcccccaatccaaattgctatgccaaggttatcatggtagcaggtgatcatagg
gttggcattttcgcgaaagaacggattggtgcaggcgaggagcttttctatgattaccgt
tatgaggctgaccgagctccggcgtgggcgcggaagcctgatgctcctggagccaaagac
atggcacaaccttccagcgggcgagcaaagaaggttgcccactga

DBGET integrated database retrieval system