KEGG   Brachypodium distachyon: 100846064Help
Entry
100846064         CDS       T01717                                 

Definition
guanylate kinase-like
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bdi  Brachypodium distachyon
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bdi00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 290 aa AA seqDB search
MLLLTRRFSSVLARSPFLARCPLPPRAVPTTAPASRPPPRRLMSSSSSGWHHSSPPPPPP
PPPPSSSSDKDQLFRGLEAALGTTFSSDPLAPPPEPMIIIISGPSGVGKDAVIKRLQEER
EEIHFVVTATSRAMRPGEVDGKDYHFVTKEEFLTMIEREELLEYALVYGEYKGIPKQQIR
DYMAKGHDIVLRVDIQGAATLREILGESAIFIFLVAESEDALVKRLIHRKTEAPDMLLVR
IATAREEVRRMKHFDYVVVNAEGKLEGAVKQVESIIDAEKAKIHKRRLRI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcttcttcttacccggaggttctcctccgtcctcgcccgctctcccttcctcgcgagg
tgcccccttccaccgcgggccgtccccaccaccgctccggcctcccgccccccgccgcgc
cgcctcatgtcctcctcctcgtccgggtggcaccactcttccccgcccccaccgccgccg
cccccgcctccctcgtcctcctccgacaaggatcagctgttccgggggctggaggcggcg
ctgggcacgacgttcagctcggacccgctggcgccgccaccggagccgatgattatcatc
atcagtggtccgagcggcgtgggaaaggatgccgtcatcaagaggctgcaagaggagcgg
gaagagatccattttgtggttactgcgacgagcagggcaatgcggccaggtgaagttgac
gggaaggactatcacttcgtcaccaaggaggaattcctcacaatgattgaaagggaggag
ttgcttgagtacgctcttgtttatggggagtacaaggggatccccaaacagcagatccgt
gattacatggccaaaggacatgacattgtcttgagagtggacattcaaggagcagcaact
ttgagagagatacttggtgaatctgcaattttcatatttctggttgcagagagcgaagac
gcacttgtcaaaaggctcattcaccgaaaaacagaagcaccagatatgctacttgtcaga
attgcaacagccagagaggaggtgagacggatgaaacattttgactatgtagttgtcaac
gctgaagggaagcttgagggcgccgttaaacaggtggagtcaatcattgatgcggagaag
gcaaaaatccacaagcgtaggctccgtatctag

DBGET integrated database retrieval system