KEGG   Brachypodium distachyon: 100846070Help
Entry
100846070         CDS       T01717                                 

Definition
U-box domain-containing protein 6-like
Organism
bdi  Brachypodium distachyon
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 1140 aa AA seqDB search
MERAEVDVDFTVPDNWKLHGELCKKLYKIVHEVSNAIPALESTRPGSSSGLLALSSLRIA
VDKAKNLLQYCSECSKLYLALSAECALSKFEKARDALLESLHQLEETLPEAIDSQIPEIA
NELENSVFALDQAEKQAGDQVKQIIQNEKKSNGFLDDNELDFFKQTAFKVGITSSATALT
ERRALRRVLERAHAEEDTKKESIASYLLHLMRKYSNHFKSETIESINSQCSSPSCSFSSI
SSSIDLLGNVPALEKLLPRSGSFNFKQIKGLSASMPLPPEELRCPISLQLMYDPVVIASG
QTYERACIEKWFSSGNTTCPKTRKQLSQLCMTPNYCIKGLIASWCEQNRVPVPSAPPESP
KLKYLRIASLKSSKCLVTNGVSTILFEETGGKDDVKLNPDDAFEKCSSHNSREAASEICE
EEEMFKENCSHQNTGEAAPERCERWLRVLNKSGECIDEQREVVEQIRFLLKDDDELRNYV
GANGITEPLTYFLKMAVEREDVQSQEVGTMALFNLAVSNNRNKQQLLSAGVIPLMEQMIQ
KLETCEAAVAMYLNLSCLEEAQAIIGASEAIPFLIKSLREEGARSDTCRMDALLTLYNLS
LHAPNISPLLSSGVIHSIHAVLTPSSSWTDKALTVLINLAMTWAGKKEIAANPSIVGDIV
LILDNGEAAEQEKAVSCLWIICSGDEGCSQTVLQEGVIPALTESALEASRLIDDLGLQDK
QQYPNSQHKRYTVKDGAPTLIPSDPIALMKSTVLSTKSKFKLFLEPFLYEKSHTRNSQKV
SDNHLSESVGSFFERHFGKEVVDYLIDPFVAGTSAGDPESLSIRHAFPGLWDLEKKYGSI
IVGAILSKLTAKGDSTKKADTSSGKGRNKQASFSFHGGMQTLVEGLHKDVGDGNVKLGTQ
VLSLACSCDRLSASDGWSISVNSKDASSKLAAKNQLFDAVIMTAPLSNVQRMKFTKGGVP
FVLDFLPKVDYLPLSLMVTAFRKEDVKRPLEGFGVLIPYKEQQKYGLKTLGTLFSSMMFP
DRAPNDQHLFTTFVGGSHNRDLAAAPTAILKQLVTSDLRKLLGVEGQPTFVKHVHWKNAF
PLYGHDYDLALEAIGKMENELPGFFYAGNNKDGLAVGNVIASGSKTADLVISYLESHQAR
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
atggagagagctgaggtcgatgtggactttactgttcctgacaattggaagctgcatgga
gaactatgtaagaaactttacaagatagttcatgaagtttcaaatgccatccctgccctt
gagagtacaagacctggaagtagttccggactgctggcattgagttccttgcgcatagcc
gtcgataaggccaagaatctacttcagtattgctcagagtgtagcaaactttacttggct
ctttcagcagaatgtgccctttctaaatttgagaaagcaagagatgctcttctagagagt
cttcaccagctggaagaaacacttccagaagcaattgattctcagatcccagagattgca
aatgagctggagaactcagtttttgctttggatcaggctgaaaagcaagctggtgaccaa
gtgaaacaaataattcagaatgagaagaaatctaatgggttccttgatgacaatgaactt
gatttttttaagcaaactgcttttaaagtcggcattacatcatccgcaacggctcttact
gagagaagggcgcttagaagggttcttgagagagcccatgcagaagaagacacgaagaaa
gaatcaatagcatcctatctgctgcatctcatgaggaaatactcaaatcattttaagagt
gaaacaatagagtccatcaactcccagtgctcaagtccttcatgctccttcagttcaata
tcaagctcgattgatctccttggaaatgtccctgctctggagaagctcctacctagatct
ggctcctttaatttcaaacagattaaaggtctatcggcgagcatgccattgccacctgag
gaactaaggtgtccaatctccctgcagctcatgtatgaccctgttgtcatcgcctcaggt
cagacgtacgagcgagcttgcattgagaaatggtttagcagcggtaacacaacgtgcccc
aaaactcggaaacagctgtcccagctctgcatgacaccaaattactgcatcaagggcctg
atagcatcttggtgtgaacagaacagggttccagttccatctgcaccgccggaatctcca
aagctcaaatatttgcggatagcgtctctcaaaagtagcaaatgcctggtgaccaatggt
gtcagcaccattttgtttgaagaaactggtggaaaagacgatgtcaagttgaaccctgat
gatgctttcgagaagtgctctagtcacaactccagagaggcggcatctgagatatgcgaa
gaggaagaaatgttcaaggagaattgctctcatcagaacaccggggaggctgcgcccgag
agatgtgaacgttggctacgcgtgctgaacaagagtggcgagtgtatcgatgagcagcgt
gaggtggtcgagcagatcaggttcctgttgaaggatgatgatgaactcaggaactatgtg
ggtgctaatggtattacagagccactgacctacttcctgaagatggctgtcgaaagagaa
gacgtgcaatctcaggaggttggaacaatggctcttttcaatctcgctgtcagcaataac
aggaacaagcagcagctcctctcagctggagtcatacccctgatggagcagatgatacag
aaactggagacctgcgaggctgccgtggcgatgtacctcaacctctcttgcctggaggag
gcacaggcgatcatcggcgcaagcgaagccatccctttcctgatcaagagcctgcgagaa
gaaggcgcccggagcgacacctgccgcatggacgccctcctcacgctgtacaacctgtcc
ctgcacgcgcccaacatctcgcccctcctctcctcaggcgtcatccatagcatccacgcc
gtcctgacgccgtcctcctcgtggacggacaaggccctcaccgtcctgatcaacctcgcg
atgacgtgggccgggaagaaggagatcgctgccaacccgtccattgtgggcgacattgtg
ctcatcctcgacaacggcgaggccgccgagcaggagaaggccgtgtcgtgcctgtggatc
atctgcagtggtgacgaagggtgcagccagacggtgctccaggaaggcgtgatcccggcg
ctgacagaaagtgccttggaggctagtagactaatcgatgatcttggtctccaggacaaa
caacagtatcctaactcccaacacaagcgttacacagttaaagatggagcaccaactctg
atcccttcagatcccattgcgttaatgaaaagcactgttctttctacgaaatcaaagttc
aagttatttctggaaccatttctctacgagaagtctcacacaaggaattcacaaaaagtg
tctgacaaccatttaagtgagagtgttgggagtttctttgagcgccactttggaaaagag
gttgttgactatcttattgatccttttgttgctggaacaagtgcaggagatcctgagtca
ttatctattcgtcatgcatttccaggtttatgggatttagaaaagaagtatggctctatc
attgttggtgctatcttgtctaaactaacagccaaaggtgactcgacaaagaaagcagac
acttcatcaggaaaaggacggaataagcaggcgtcattttcatttcatggtggtatgcag
acactagtagagggacttcacaaggacgttggagatggtaatgtgaagcttggaacacaa
gtgctgtcactggcatgtagctgtgacagactctctgcatcagatgggtggtcaatttct
gtcaattcaaaggatgctagcagcaagctggctgcaaagaaccaattgtttgatgcagtt
ataatgacagctccactgtctaatgtccagaggatgaagtttacaaaaggcggagttccc
tttgtgctagactttcttcctaaggtggattatctgccattgtccctcatggtaacagct
tttaggaaggaagatgtcaaaagaccgttggaaggatttggggtcttgataccctataag
gaacaacaaaaatatggtctgaaaactcttggaactctcttttcctctatgatgtttcca
gaccgagctcctaatgaccagcacctatttacaacattcgttgggggaagccacaataga
gatctcgctgcagctccaacagctatcttgaaacagcttgtgacctctgaccttagaaaa
ctcctgggtgtagagggccaaccaacctttgtgaagcacgtacattggaaaaatgctttt
cctttgtatggccatgattatgatttggcattggaagctataggaaagatggagaatgaa
cttccaggcttcttctacgcagggaataacaaggatgggttggctgttggaaatgttata
gcttcaggaagtaagactgctgaccttgtgatctcatatcttgagtcgcatcaagcaaga
taa

DBGET integrated database retrieval system