KEGG   Brachypodium distachyon: 100846070Help
Entry
100846070         CDS       T01717                                 

Definition
protoporphyrinogen oxidase, mitochondrial-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bdi  Brachypodium distachyon
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100846070
Enzymes [BR:bdi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     100846070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 544 aa AA seqDB search
MLTSATASPSASTRFSSTCRPCRSDSVPARRPRPVLAMAASDDPRAAPARSVAVVGAGVS
GLVAAHRLRKSGVRVTVFEADDRAGGKIRTNSDSGFLWDEGANTMTESALEASRLIDDLG
LQDKQQYPNSQHKRYTVKDGAPTLIPSDPIALMKSTVLSTKSKFKLFLEPFLYEKSHTRN
SQKVSDNHLSESVGSFFERHFGKEVVDYLIDPFVAGTSAGDPESLSIRHAFPGLWDLEKK
YGSIIVGAILSKLTAKGDSTKKADTSSGKGRNKQASFSFHGGMQTLVEGLHKDVGDGNVK
LGTQVLSLACSCDRLSASDGWSISVNSKDASSKLAAKNQLFDAVIMTAPLSNVQRMKFTK
GGVPFVLDFLPKVDYLPLSLMVTAFRKEDVKRPLEGFGVLIPYKEQQKYGLKTLGTLFSS
MMFPDRAPNDQHLFTTFVGGSHNRDLAAAPTAILKQLVTSDLRKLLGVEGQPTFVKHVHW
KNAFPLYGHDYDLALEAIGKMENELPGFFYAGNNKDGLAVGNVIASGSKTADLVISYLES
HQAR
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgctcacttctgccaccgcctccccctctgcctccacccgcttctcctcgacgtgccgt
ccctgccgctccgattccgtgcctgcgcgccgcccccgccccgtgctcgccatggccgcc
tccgacgacccgcgggcggcgccggccaggtcggtcgccgttgtcggcgccggcgtcagt
gggctcgtggcagcgcaccggctgaggaagagcggcgtgcgggtcacggtgttcgaggcg
gacgaccgggcgggagggaagatacggaccaactccgacagtggattcctctgggacgaa
ggggccaacaccatgacagaaagtgccttggaggctagtagactaatcgatgatcttggt
ctccaggacaaacaacagtatcctaactcccaacacaagcgttacacagttaaagatgga
gcaccaactctgatcccttcagatcccattgcgttaatgaaaagcactgttctttctacg
aaatcaaagttcaagttatttctggaaccatttctctacgagaagtctcacacaaggaat
tcacaaaaagtgtctgacaaccatttaagtgagagtgttgggagtttctttgagcgccac
tttggaaaagaggttgttgactatcttattgatccttttgttgctggaacaagtgcagga
gatcctgagtcattatctattcgtcatgcatttccaggtttatgggatttagaaaagaag
tatggctctatcattgttggtgctatcttgtctaaactaacagccaaaggtgactcgaca
aagaaagcagacacttcatcaggaaaaggacggaataagcaggcgtcattttcatttcat
ggtggtatgcagacactagtagagggacttcacaaggacgttggagatggtaatgtgaag
cttggaacacaagtgctgtcactggcatgtagctgtgacagactctctgcatcagatggg
tggtcaatttctgtcaattcaaaggatgctagcagcaagctggctgcaaagaaccaattg
tttgatgcagttataatgacagctccactgtctaatgtccagaggatgaagtttacaaaa
ggcggagttccctttgtgctagactttcttcctaaggtggattatctgccattgtccctc
atggtaacagcttttaggaaggaagatgtcaaaagaccgttggaaggatttggggtcttg
ataccctataaggaacaacaaaaatatggtctgaaaactcttggaactctcttttcctct
atgatgtttccagaccgagctcctaatgaccagcacctatttacaacattcgttggggga
agccacaatagagatctcgctgcagctccaacagctatcttgaaacagcttgtgacctct
gaccttagaaaactcctgggtgtagagggccaaccaacctttgtgaagcacgtacattgg
aaaaatgcttttcctttgtatggccatgattatgatttggcattggaagctataggaaag
atggagaatgaacttccaggcttcttctacgcagggaataacaaggatgggttggctgtt
ggaaatgttatagcttcaggaagtaagactgctgaccttgtgatctcatatcttgagtcg
catcaagcaagataa

DBGET integrated database retrieval system