KEGG   Brachypodium distachyon: 100846139Help
Entry
100846139         CDS       T01717                                 

Definition
josephin-like protein-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100846139
Peptidases [BR:bdi01002]
 Cysteine Peptidases
  Family C86
   100846139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 199 aa AA seqDB search
MEPGAKSEANQNEEGSGAVGSSGGSSKVYHERQRMQFCLLHALNNLMQEKESFTRAELDG
ISENLVLTDPNKDKWTPLSLIFKPHHNALTGNYDVNVLITALETRKTNVVWHDRRKGASS
IDLDAGALVGLMINVPVKRLRGLWTGRHWVAIRSIDGIWFNLDSDFSSPKQFQGKEQLIE
FLDSILSQGGELMIVLRDE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggagccgggagccaaatcagaagcaaaccaaaacgaggaaggatcaggtgcggtggga
agcagcggcggcagcagcaaggtttaccacgagaggcaaaggatgcagttctgcctcctc
cacgccctcaacaaccttatgcaggaaaaggaatctttcacccgagctgagttggatggt
atttctgaaaatcttgttcttactgatccgaacaaggacaaatggactcctctatcattg
atttttaagccacaccacaatgcattaactgggaactacgacgtaaatgtacttatcaca
gcgttagaaactagaaagacaaatgtagtctggcatgatcgtcgaaagggggcatcttca
atagatttggatgcaggagcactggttggtctgatgatcaatgtgcctgtcaagaggttg
agggggctctggaccggcaggcattgggtggcaattcggagcattgatggtatctggttt
aacttggacagtgatttttcttcacccaagcagtttcagggcaaagaacaactaattgag
tttctggacagcattctcagtcaaggtggagaactcatgatcgtgctgcgagacgaataa

DBGET integrated database retrieval system