KEGG   Brachypodium distachyon: 100846303Help
Entry
100846303         CDS       T01717                                 

Definition
rae1-like protein At1g80670-like
Orthology
K14298  
mRNA export factor
Organism
bdi  Brachypodium distachyon
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100846303
Messenger RNA biogenesis [BR:bdi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100846303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 345 aa AA seqDB search
MASFNAAGAGAANPNPNKSLEVNSPPGDSVSSLSFSPKANHLVATSWDNQVRCWEVQPGG
QCQAKASISHDQPVLCSAWKDDGTTVFSGGCDKLVKMWPLLSNGQPTVFSGHDAPVKELA
WIPQINLLVSGSWDKTLRYWDPRQPQPVHVQQLPERCYALSLSYPLMAVGTADRKVVIFN
LQNPQAEFKRIDSPLKFQTRCLAAFPDQQGFLVGSIEGRVGVHHVDDSQQSKNFTFKCHR
EGNDIYSVNSLNFHPVHHTFATAGSDGGFNFWDKDSKQRLKAFSKCPSPITCSTFNQDGS
IFAYAVCYDWSKGAEKHNPSTAKTNIFLHSVQESDVKGKPRAGKK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctttaacgccgccggcgctggcgcggccaaccccaaccccaacaaatccctc
gaggtgaactcgccgcccggagattcggtttccagcctgagctttagtcccaaggcgaac
cacctcgtcgctacctcctgggacaaccaggttcggtgctgggaggtccagcctggtggc
caatgccaagccaaggcgtcgatttcgcatgatcagccggtgctgtgctcagcctggaag
gacgatggtactactgttttttcgggagggtgtgataaactggttaagatgtggccgttg
ctgtctaatgggcagcccacggtcttctcagggcatgatgcgccggttaaagaacttgcc
tggattccacaaatcaatcttcttgtcagtgggagctgggataagactttgaggtactgg
gaccctagacaacctcagccagtacatgttcagcaacttcccgagcgctgctatgctctc
tcacttagttatcctctaatggcggttggcactgctgatcgcaaagtagttatcttcaat
ctgcagaacccacaggctgaattcaagaggatcgactcacctctgaaattccagacaagg
tgtcttgctgcattccctgatcaacaagggttcttggttggatcaatagagggacgcgtt
ggtgttcatcatgtggatgactctcagcaaagcaaaaattttacattcaaatgtcaccgc
gagggcaatgatatatactctgttaactcattgaacttccatcctgtgcaccatacattt
gcaactgcaggttctgatggaggtttcaacttttgggacaaggacagtaaacaaagactc
aaggcttttagcaagtgcccatcacccattacatgcagcacattcaatcaggatggttca
atctttgcttatgcggtatgctatgattggagcaagggtgctgagaagcataatccttct
actgcaaagacaaatatctttctacatagcgtgcaggaatctgatgtcaaaggaaagccc
cgtgctggaaagaagtag

DBGET integrated database retrieval system