KEGG   Brachypodium distachyon: 100846323Help
Entry
100846323         CDS       T01717                                 

Definition
(RefSeq) mitogen-activated protein kinase 6
Organism
bdi  Brachypodium distachyon
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 375 aa AA seqDB search
MDTSGGGGAGGAAQIQGMATHGGRYVLYNVYGNLFEVASKYAPPIRPIGRGAYGIVCAAV
SSDTGEEVAIKKIGNAFDNHIDAKRTLREIKLLRHMDHENIIAIKDIIRPPRRDDFKDVY
IVTELMDTDLHQIIRSNQPLTDDHCQYFLYQLLRGLKYVHSANVLHRDLKPSNLFLNANC
DLKIADFGLARTTSETDLMTEYVVTRWYRAPELLLNCSQYTAAIDVWSVGCILGEIITRQ
PLFPGRDYIQQLKLITELIGSPDDSSLGFLRSDNARRYMKQLPQYPRQDFRLRFRNMSDG
AVDLLERMLVFDPSRRITVDEALHHPYLASLHDINEEPTCPAPFSFDFEQPSFTEEHMKE
LIWRETLAFNPDPPY
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatacttccggcggcggcggcgcgggtggggcggcgcagatccaggggatggcgacg
cacggcgggcgctacgtgctgtacaacgtgtacgggaacctcttcgaggtcgcctccaag
tacgcccctcccatacgccccatcggccgcggcgcctacggcattgtctgcgcggccgtc
agttcggatactggagaggaggttgcgatcaagaaaattggaaatgcatttgacaaccac
atcgacgccaagcggacactgagagaaataaagcttcttcgccacatggaccatgagaat
attattgccataaaggacataatacgccccccaagaagagacgattttaaggatgtctac
attgttactgagttgatggacaccgatctccatcagatcatacgctcaaatcagccattg
accgatgaccattgccagtacttcttgtatcagttgctacgagggctaaaatatgtgcat
tcagcaaatgtcttgcaccgtgatctgaagccaagtaatttattcctaaacgcaaattgt
gatctcaagattgcggactttgggcttgcaaggaccacatccgagactgatctcatgaca
gagtatgtggtcactcgttggtaccgagcaccagagttgctgttgaactgttcacaatat
actgctgctattgatgtctggtcagttgggtgcatacttggtgaaattattactcgccaa
cccctatttcctgggagggattacattcaacaactaaaattgatcactgagttgataggg
tcaccagatgattcgagcctgggatttcttcggagtgataatgcacgaagatatatgaaa
caactaccacagtacccaaggcaggacttccgcttgcgcttccgcaacatgtctgatggt
gcagttgatctgttagagagaatgctggtgtttgatccaagcagacggatcactgttgat
gaggctctgcatcatccatacttggcttctcttcatgacatcaatgaagaacccacatgc
ccggcacccttcagctttgattttgagcaaccttcatttacagaggaacatatgaaagaa
ctcatctggagggaaactttagcatttaaccctgatcctccctactaa

DBGET integrated database retrieval system