KEGG   Brachypodium distachyon: 100846375Help
Entry
100846375         CDS       T01717                                 

Definition
acetyl-CoA carboxylase 2-like
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
bdi  Brachypodium distachyon
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bdi01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bdi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bdi00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:bdi00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 2335 aa AA seqDB search
MGSTHLPIVGFNASTTPSLSTLRQLNSAGTAFQSSAPSRTSPKKKSRRVQSIREDGDGGV
SDPAGHNKSIRQGIAGIIDLPKEGTSAPEVDISHGSEDPRGSYQMNGILNEAHNGRHASL
SKVVDFCMALGGKTPIHSVLVANNGMAAAKFMRSIRTWANDTFGSEKAIQLIAMATPEDM
RINAEHIRIADQFVEVPGGTNNNNYANVQLIVEIAERTGVSAVWPGWGHASENPELPDAL
TAKGIVFLGPPASSMNALGDKVGSALIAQAAGVPTLPWSGSQVEIPLELCLDSIPEEMYR
KACVTTAEEAVSSCQMIGYPAMIKASWGGGGKGIRKVNNDDEVRALFKQVQGEVPGSPIF
IMRLASQSRHLEVQLLCDQYGNVAALHSRDCSVQRRHQKIIEEGPVTVAPRETVKELEQA
ARRLAKAVGYVGAATVEYLYSMDTGEYYFLELNPRLQVEHPVTEWIAEVNLPAAQVAVGM
GIPLWQVPEIRRFYGMDHGGGYDIWRKTAALATPFNFDEVDSQWPKGHCVAVRITSEDPD
DGFKPTGGKVKEISFKSKPNVWAYFSVKSGGGIHEFADSQFGHVFAYGVSRSAAITSMAL
ALKEIQIRGEIHSNVDYTVDLLNASDFRENKIHTGWLDTRIAMRVQAERPPWYISVVGGA
LYKTITTNTATVSDYVSYLIKGQIPPKHISLVNSTVSLNIEESKYAIETIRSGHGSYRLR
MNGSVIEANVQTLCDGGLLMQLDGNSHVIYAEEEAGGTRLLIDGKTCLLQNDHDPSRLLA
ETPCKLLRFLVADGAHVDADVPYAEVEVMKMCMPLLSPAAGVIHVLLSEGQAMQAGDLIA
RLDLDDPSAVKRAEPFDGFFPEMSLPIAASCQVHKRCAASLNAARMVLAGYEHPINKVVQ
DLVCCLDTPELPFLQWEELMSVLATRLPRDLKSELEGKYSDYKLTVDHGKNKDFPTKTLR
GIIEENLACCSEKEKATNERLVEPLMSLLKSYEGGRENHAHFIVKSLFEEYLSVEELFSD
DIQSDVIERLRLQHSKDLQKVVDIVLSHQGVRNKTKLILTLMEKLVYPNPSAYRDQLIRF
SSLNHKRYYKLALKASELLEQTKLGELRTSIARSLSELEMFTEERVGLSLQERTLAIDES
MGDLVTAPLPVEDALISLFDCTDQTLQQRVIETYISRLYQPHLVKDSVQLKYKESGVIGI
WEFAEEHANIRNGQKPTLPEKRWGAMVILKSLESVSTAIGVALKDASHYSSSEGNIMHIA
LLGDDNQINKSEDSGDNDQAQDRIDKLSVILKQNIVTADLRAAGVKVVSCIVQRDGARMP
MRRTFLLSDEKLCFEEEPILRHVEPPLSALLELDKLKVKGYNEMKYTPSRDRQWHIYTLR
NTENPKMLHRVFFRTLVRQPTAGNKFTSGRTSDIEAGHAEESLSFTSSSILRSLMTAIEE
LELHAIRTGHSHMYLCILREQKLLDLVPVSGSTVVDVGQDEATACSLLKEMALKIHELVG
ARMHHLSVCQWEVKLKLDSDGPASGTWRVVTTNVTSHTCTVDIYREAEDTEAQKLVYHSA
TSLSAPLHGVALNNPYQPLSVIDLKRCSARNNRTTYCYDFPLAFETAVRKSWYNINTENK
QCYVKATELVFADKNGSWGTPLIPMDRPAGLNDIAMVAWILDMSTPEFPNGRQIIVIAND
ITFRAGSFGPREDAFFESVTNLACERKLPLIYLAANSGARIGIADEVKSCFRVGWSDDGS
PERGFQYIYLTEEDYARISSSVIAHKTQLTSGESRWVIDSVVGKEDGLGVENIHGSAAIA
SAYSRAYKETFTLTFVTGRTVGIGAYLARLGIRCIQRTDQPIILTGFSALNKLLGREVYS
SHMQLGGPKIMATNGVVHLTVPDDLEGVSNILRWLSFVPAKIGGPLPITKPLDPPDRPVE
YVPENACDPRAAISGIEDSHGKWLGGMFDKDSFVETFEGWAKTVVTGRAKLGGIPVGVIA
VETQTMMQLIPADPGQLDSHERSVPRAGQVWFPDSATKTAQALLDFNREGLPLFILANWR
GFSGGQRDLFEGILQAGSTIVENLRTYNQPAFVYIPKAAELRGGAWVVVDSKINPDRIEC
YAERTAKGNVLEPQGLIEIKFRSEELQDCMGRLDPELINLKAKLQAAKHENGTLPDVESL
QKSIEARKKQLLPLYTQIAIRFAELHDTSLRMAAKGVIKKVVDWEDSRSFFYKRLQRRIS
EDVIAKEIRGVTGEQFSHQSALELIKKWYLASQVAEVGNTEWDDDDAFVAWKDNPENYKA
YIKELRAQKVSQVLLDLGDSSSDLQALPLGLSMLLDKMDPSRRADFVEEIRKVLG
NT seq 7008 nt NT seq  +upstreamnt  +downstreamnt
atggggtccacacatctgcccatcgttggatttaatgcgtcgacaacgccatcactatcc
acccttcgccagctaaattcggctggcactgcattccagtcatctgccccttcaagaacc
tccccgaagaagaaaagtcgtcgtgttcagtcaataagggaggatggtgatggaggcgtg
tcagatcccgcaggacataacaagtctattcgccaaggtattgctggcatcattgacttg
ccaaaggaggggacatcagctccagaagtggatatttcacatgggtctgaagaccccagg
ggctcctaccaaatgaatggaatattgaatgaagcacacaatgggaggcatgcttcactg
tctaaggttgtcgacttttgtatggcattgggtggcaaaacaccaattcacagtgtatta
gttgccaacaatggaatggcagcagcgaagttcatgcgcagtatccgaacatgggctaat
gacacatttggatcagagaaagcgattcagttgatagctatggctacgccggaagacatg
aggatcaatgcagaacacattagaattgctgatcaatttgttgaagtacctggtggaaca
aacaataacaactatgcaaatgttcaactcatagtggagatagcagagagaacaggtgtt
tctgctgtttggccgggttggggccatgcatctgagaatcccgaacttccagatgcacta
actgcaaaaggaattgtttttcttgggccaccagcatcatcaatgaatgcactaggtgac
aaggtcggttcagctctcattgctcaagcagcaggtgttcctactcttccttggagtgga
tcacaggtggaaattccattagaactttgcttggactcgatacctgaggagatgtatagg
aaagcttgcgttactaccgcagaggaagcagtttcaagttgtcagatgattggttatcct
gccatgattaaggcatcctggggtggtggtggtaaagggataagaaaggttaataatgac
gatgaggtcagagccttgtttaagcaagtccaaggagaagttcccggctccccaatattt
atcatgcggcttgcatctcagagtcgacatcttgaagttcaattgctttgcgatcaatat
ggaaatgttgcagcacttcatagtcgtgattgcagtgtacaacggcgacaccaaaagatt
attgaggaaggtccagttacagtggctcctcgtgagacagtaaaagagctagagcaggct
gcaaggaggcttgctaaggctgtgggttatgttggtgctgctacggttgaatatctgtac
agcatggacactggcgaatactattttctggagcttaatccacggttgcaggttgagcat
ccagtcactgagtggatagcggaagtaaatttgcctgctgctcaagttgcagttggaatg
ggtataccactttggcaggttccagagatcagacgcttttatggaatggaccatggaggt
ggctatgatatttggaggaaaacagcagctcttgctactccgtttaactttgatgaagta
gattctcaatggcccaagggtcattgtgtagctgttaggataactagtgaggatccagat
gatggattcaagcctactggtggaaaagtaaaggagataagttttaaaagcaagccaaat
gtttgggcctatttctcagtcaagtccggtggaggcattcatgaatttgctgactctcag
tttgggcatgtatttgcttatggagtgtctagatcagcagcaataactagcatggctctt
gcattaaaagagattcaaattcgtggagaaattcattcaaatgttgattatacagttgat
ctcttgaatgcctcggatttcagagaaaataagattcatactggttggctggataccaga
atagccatgcgtgttcaagctgagagacctccttggtatatttcagtggttggaggtgct
ctatataaaacaataactaccaatacagccactgtttctgattatgttagctatctcatc
aagggccagattccaccaaagcatatatcccttgtcaattcaactgtttctttgaatata
gaggaaagcaaatatgcaattgagactataaggagtggacatggtagctacagattgcgg
atgaatggatcagttattgaagcaaatgtacaaacactctgtgatggtggcctgttaatg
cagctggatggaaacagccatgtaatttatgctgaagaagaggcaggtggtacacggctt
cttattgatggaaagacctgtttgttacagaatgatcacgatccgtcaaggttgttagct
gagacaccgtgcaaacttcttcgtttcttggttgccgatggtgctcatgttgatgcggat
gtaccatatgcggaagtcgaggttatgaagatgtgcatgcccctcttgtcccctgctgct
ggtgtcattcatgttttgttgtctgagggccaggcgatgcaggctggtgatctgatagca
aggcttgatcttgacgatccttctgctgtgaagagagcagagccatttgacggatttttt
ccggaaatgagccttcctattgctgcttcttgccaagttcacaaaagatgcgctgcaagc
ctgaatgctgctcgcatggtccttgcaggatatgagcacccaatcaacaaagttgtacaa
gatttggtttgctgtctagatactcctgagcttcctttcctacaatgggaagagctcatg
tctgttttagcaactagacttccaagagaccttaaaagtgagctagagggtaaatacagt
gactataagttaactgttgaccatggaaagaacaaggatttccctaccaagacgctaaga
gggataatcgaggaaaatcttgcatgttgttctgagaaggaaaaggctacaaatgagagg
cttgttgagcctcttatgagtctgctgaagtcctatgagggtgggagagaaaaccatgcc
cactttattgtcaagtcccttttcgaggagtatctctctgtcgaggaacttttcagtgat
gacattcagtctgacgtgattgaacgcctgcgcctacaacatagtaaagacctccagaag
gttgtagacattgtgctgtctcaccagggtgtgagaaacaaaactaagctgatattaaca
ctcatggagaaactggtttatccaaacccgtctgcctacagggatcagttgattcgcttt
tcttccctcaatcataaaagatattataagttggcacttaaagctagcgaacttctggaa
caaaccaagcttggtgaactccgcactagcattgcaaggagcctttcagagctggagatg
tttactgaagaaagggtgggtctctccctgcaagagagaacattggccattgatgagagc
atgggggatttagtcactgccccactgccagttgaagatgcacttatttctttgtttgat
tgtactgatcaaactcttcagcaaagagtgattgagacatacatatctcgattgtaccag
cctcatcttgtgaaggatagcgtccagctgaaatataaggaatctggtgttattggcata
tgggaatttgctgaagagcacgctaatataagaaatggacaaaagcccactcttcctgag
aagagatggggtgccatggttattctgaagtcacttgaatctgtgtcaacagccattgga
gttgcgctaaaagatgcatcacactattccagctctgagggtaacataatgcatattgct
ttgttgggtgatgataatcaaattaataaatctgaagacagtggtgataatgatcaagct
caagacaggatagacaagctttccgtgatactgaagcagaatattgtcacagctgatctc
cgtgctgctggtgtaaaggttgttagttgcattgttcaaagagatggagcacgaatgcct
atgcgccgtaccttccttttgtcagatgaaaaactttgttttgaggaagagccgattctc
cggcatgtggagcctcccctttctgcgctccttgagttggataagttgaaagtgaaagga
tacaacgagatgaagtatacaccatctcgcgatcgtcagtggcatatttatacgttgaga
aataccgaaaaccccaaaatgttgcatagggtatttttccgaactcttgtcaggcagcct
actgccggcaacaagtttacatcaggccgtaccagtgatattgaagccggacatgctgag
gaatctctttcatttacatcgagcagcatattaagatcattgatgactgctatagaagaa
ttggagcttcatgcgattaggactggccattcccatatgtatttgtgcatattgagagaa
caaaagcttcttgaccttgttcctgtttcagggagcactgttgtggacgttggccaagat
gaagctactgcatgctcgctcttgaaagaaatggctctaaagatacatgaacttgttggt
gcaagaatgcatcatctttctgtatgccaatgggaagtgaaactcaaattggacagcgat
gggcctgccagtggtacctggagagtcgtaacaactaatgttactagtcatacatgtact
gtggatatctaccgggaggctgaagatacagaagcacagaaactagtataccattctgcc
acatctttatctgctcctttgcatggtgtggcactgaataatccatatcagcctttgagt
gtaattgatctaaaacgttgctctgctaggaacaacagaactacatactgctatgatttt
ccactggcatttgaaactgcggtgcgaaaatcatggtataacattaacactgaaaataaa
cagtgttatgttaaagcaacggagctggtatttgctgacaagaatgggtcgtggggcact
ccattaattcctatggatcgtcctgctgggctcaatgacattgctatggtagcttggatc
ttggacatgtccactcctgaatttcccaatggcaggcagattattgttatcgcaaatgat
attacttttagagcaggatcgtttggcccaagggaagatgcattttttgaatctgttacg
aacctagcttgtgaaaggaaacttcctcttatctacttggcagcaaactctggtgctcgg
attggcatagcagatgaagtgaaatcttgcttccgtgttggctggtctgacgatggcagc
ccggaacgagggtttcagtacatttatctgactgaagaagactatgctcggattagctct
tctgttatagcgcacaagacacagctaactagtggtgaaagtaggtgggttattgattct
gttgtgggcaaggaggatgggctaggtgtggagaatatacatggaagtgctgctattgcc
agtgcttattctagggcgtacaaggagacatttacgcttacatttgtgactggacggact
gttggaataggagcttatcttgctcgacttggcatacggtgtatacagcgtaccgaccag
cccattattctaacagggttttctgccctgaacaagcttcttgggagggaagtgtacagt
tcccatatgcagttgggtggtcccaaaatcatggcaacaaatggtgttgtccatctgact
gttccagatgatcttgaaggagtttctaacatattgaggtggctcagctttgttcctgcc
aagattggtggacctcttcctattacaaaacctttggacccaccagacagacccgttgaa
tacgttcctgaaaatgcatgtgatcctcgtgcggccatcagtggtattgaagatagccac
gggaaatggttgggtggcatgtttgacaaagacagttttgtggagacatttgaaggatgg
gctaagacagttgttactggcagagcaaaacttggagggattcctgtgggtgttatagct
gtggagacacagaccatgatgcagctcatccctgctgatccaggccaacttgattcccat
gagcgatctgttcctcgtgctgggcaagtctggtttccagattctgccactaagacagct
caggcgttgttggacttcaaccgtgaaggattacctctgttcatccttgctaactggaga
ggcttctctggcggtcaaagagatctttttgaaggaatccttcaggctgggtcaacaatc
gttgagaaccttaggacatacaatcagcctgcctttgtatatattcccaaggctgcagag
ttacggggaggggcttgggtcgtggttgatagcaagataaatcccgaccgcatcgagtgc
tatgctgagaggactgcaaaaggcaatgttcttgagcctcaagggttgattgagatcaag
ttcagatctgaggaactccaagactgcatgggtaggcttgacccagaattgattaatctg
aaagcaaaactccaagcagcaaagcatgaaaatggaactctacctgatgtagaatccctt
cagaagagcattgaagctcggaagaaacagttgctgcctttgtacactcaaatcgcgata
aggttcgctgaattgcatgacacttcactcagaatggctgctaaaggcgtgattaagaaa
gttgttgactgggaagattcacggtctttcttctacaagagattacaaaggaggatatct
gaggatgttattgcaaaagaaattagaggtgtaactggtgagcagttttctcaccaatca
gcactcgagctgattaagaaatggtatttagcttctcaggtagctgaggtaggaaacact
gaatgggatgatgacgatgcttttgttgcctggaaggacaaccctgaaaattataaggcg
tatatcaaagaacttagagctcaaaaggtatctcaggtgctcttggatctcggagactcc
agttcggatttacaagccttgccactaggtctttccatgctactagataagatggatccc
tcaaggagagccgactttgttgaggaaatcaggaaggtccttggttga

DBGET integrated database retrieval system