KEGG   Brachypodium distachyon: 100846375Help
Entry
100846375         CDS       T01717                                 

Definition
acetyl-CoA carboxylase 2-like
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
bdi  Brachypodium distachyon
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100846375
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100846375
   00640 Propanoate metabolism
    100846375
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100846375
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100846375
Enzymes [BR:bdi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100846375
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100846375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 2335 aa AA seqDB search
MGSTHLPIVGFNASTTPSLSTLRQLNSAGTAFQSSAPSRTSPKKKSRRVQSIREDGDGGV
SDPAGHNKSIRQGIAGIIDLPKEGTSAPEVDISHGSEDPRGSYQMNGILNEAHNGRHASL
SKVVDFCMALGGKTPIHSVLVANNGMAAAKFMRSIRTWANDTFGSEKAIQLIAMATPEDM
RINAEHIRIADQFVEVPGGTNNNNYANVQLIVEIAERTGVSAVWPGWGHASENPELPDAL
TAKGIVFLGPPASSMNALGDKVGSALIAQAAGVPTLPWSGSQVEIPLELCLDSIPEEMYR
KACVTTAEEAVSSCQMIGYPAMIKASWGGGGKGIRKVNNDDEVRALFKQVQGEVPGSPIF
IMRLASQSRHLEVQLLCDQYGNVAALHSRDCSVQRRHQKIIEEGPVTVAPRETVKELEQA
ARRLAKAVGYVGAATVEYLYSMDTGEYYFLELNPRLQVEHPVTEWIAEVNLPAAQVAVGM
GIPLWQVPEIRRFYGMDHGGGYDIWRKTAALATPFNFDEVDSQWPKGHCVAVRITSEDPD
DGFKPTGGKVKEISFKSKPNVWAYFSVKSGGGIHEFADSQFGHVFAYGVSRSAAITSMAL
ALKEIQIRGEIHSNVDYTVDLLNASDFRENKIHTGWLDTRIAMRVQAERPPWYISVVGGA
LYKTITTNTATVSDYVSYLIKGQIPPKHISLVNSTVSLNIEESKYAIETIRSGHGSYRLR
MNGSVIEANVQTLCDGGLLMQLDGNSHVIYAEEEAGGTRLLIDGKTCLLQNDHDPSRLLA
ETPCKLLRFLVADGAHVDADVPYAEVEVMKMCMPLLSPAAGVIHVLLSEGQAMQAGDLIA
RLDLDDPSAVKRAEPFDGFFPEMSLPIAASCQVHKRCAASLNAARMVLAGYEHPINKVVQ
DLVCCLDTPELPFLQWEELMSVLATRLPRDLKSELEGKYSDYKLTVDHGKNKDFPTKTLR
GIIEENLACCSEKEKATNERLVEPLMSLLKSYEGGRENHAHFIVKSLFEEYLSVEELFSD
DIQSDVIERLRLQHSKDLQKVVDIVLSHQGVRNKTKLILTLMEKLVYPNPSAYRDQLIRF
SSLNHKRYYKLALKASELLEQTKLGELRTSIARSLSELEMFTEERVGLSLQERTLAIDES
MGDLVTAPLPVEDALISLFDCTDQTLQQRVIETYISRLYQPHLVKDSVQLKYKESGVIGI
WEFAEEHANIRNGQKPTLPEKRWGAMVILKSLESVSTAIGVALKDASHYSSSEGNIMHIA
LLGDDNQINKSEDSGDNDQAQDRIDKLSVILKQNIVTADLRAAGVKVVSCIVQRDGARMP
MRRTFLLSDEKLCFEEEPILRHVEPPLSALLELDKLKVKGYNEMKYTPSRDRQWHIYTLR
NTENPKMLHRVFFRTLVRQPTAGNKFTSGRTSDIEAGHAEESLSFTSSSILRSLMTAIEE
LELHAIRTGHSHMYLCILREQKLLDLVPVSGSTVVDVGQDEATACSLLKEMALKIHELVG
ARMHHLSVCQWEVKLKLDSDGPASGTWRVVTTNVTSHTCTVDIYREAEDTEAQKLVYHSA
TSLSAPLHGVALNNPYQPLSVIDLKRCSARNNRTTYCYDFPLAFETAVRKSWYNINTENK
QCYVKATELVFADKNGSWGTPLIPMDRPAGLNDIAMVAWILDMSTPEFPNGRQIIVIAND
ITFRAGSFGPREDAFFESVTNLACERKLPLIYLAANSGARIGIADEVKSCFRVGWSDDGS
PERGFQYIYLTEEDYARISSSVIAHKTQLTSGESRWVIDSVVGKEDGLGVENIHGSAAIA
SAYSRAYKETFTLTFVTGRTVGIGAYLARLGIRCIQRTDQPIILTGFSALNKLLGREVYS
SHMQLGGPKIMATNGVVHLTVPDDLEGVSNILRWLSFVPAKIGGPLPITKPLDPPDRPVE
YVPENACDPRAAISGIEDSHGKWLGGMFDKDSFVETFEGWAKTVVTGRAKLGGIPVGVIA
VETQTMMQLIPADPGQLDSHERSVPRAGQVWFPDSATKTAQALLDFNREGLPLFILANWR
GFSGGQRDLFEGILQAGSTIVENLRTYNQPAFVYIPKAAELRGGAWVVVDSKINPDRIEC
YAERTAKGNVLEPQGLIEIKFRSEELQDCMGRLDPELINLKAKLQAAKHENGTLPDVESL
QKSIEARKKQLLPLYTQIAIRFAELHDTSLRMAAKGVIKKVVDWEDSRSFFYKRLQRRIS
EDVIAKEIRGVTGEQFSHQSALELIKKWYLASQVAEVGNTEWDDDDAFVAWKDNPENYKA
YIKELRAQKVSQVLLDLGDSSSDLQALPLGLSMLLDKMDPSRRADFVEEIRKVLG
NT seq 7008 nt NT seq  +upstreamnt  +downstreamnt
atggggtccacacatctgcccatcgttggatttaatgcgtcgacaacgccatcactatcc
acccttcgccagctaaattcggctggcactgcattccagtcatctgccccttcaagaacc
tccccgaagaagaaaagtcgtcgtgttcagtcaataagggaggatggtgatggaggcgtg
tcagatcccgcaggacataacaagtctattcgccaaggtattgctggcatcattgacttg
ccaaaggaggggacatcagctccagaagtggatatttcacatgggtctgaagaccccagg
ggctcctaccaaatgaatggaatattgaatgaagcacacaatgggaggcatgcttcactg
tctaaggttgtcgacttttgtatggcattgggtggcaaaacaccaattcacagtgtatta
gttgccaacaatggaatggcagcagcgaagttcatgcgcagtatccgaacatgggctaat
gacacatttggatcagagaaagcgattcagttgatagctatggctacgccggaagacatg
aggatcaatgcagaacacattagaattgctgatcaatttgttgaagtacctggtggaaca
aacaataacaactatgcaaatgttcaactcatagtggagatagcagagagaacaggtgtt
tctgctgtttggccgggttggggccatgcatctgagaatcccgaacttccagatgcacta
actgcaaaaggaattgtttttcttgggccaccagcatcatcaatgaatgcactaggtgac
aaggtcggttcagctctcattgctcaagcagcaggtgttcctactcttccttggagtgga
tcacaggtggaaattccattagaactttgcttggactcgatacctgaggagatgtatagg
aaagcttgcgttactaccgcagaggaagcagtttcaagttgtcagatgattggttatcct
gccatgattaaggcatcctggggtggtggtggtaaagggataagaaaggttaataatgac
gatgaggtcagagccttgtttaagcaagtccaaggagaagttcccggctccccaatattt
atcatgcggcttgcatctcagagtcgacatcttgaagttcaattgctttgcgatcaatat
ggaaatgttgcagcacttcatagtcgtgattgcagtgtacaacggcgacaccaaaagatt
attgaggaaggtccagttacagtggctcctcgtgagacagtaaaagagctagagcaggct
gcaaggaggcttgctaaggctgtgggttatgttggtgctgctacggttgaatatctgtac
agcatggacactggcgaatactattttctggagcttaatccacggttgcaggttgagcat
ccagtcactgagtggatagcggaagtaaatttgcctgctgctcaagttgcagttggaatg
ggtataccactttggcaggttccagagatcagacgcttttatggaatggaccatggaggt
ggctatgatatttggaggaaaacagcagctcttgctactccgtttaactttgatgaagta
gattctcaatggcccaagggtcattgtgtagctgttaggataactagtgaggatccagat
gatggattcaagcctactggtggaaaagtaaaggagataagttttaaaagcaagccaaat
gtttgggcctatttctcagtcaagtccggtggaggcattcatgaatttgctgactctcag
tttgggcatgtatttgcttatggagtgtctagatcagcagcaataactagcatggctctt
gcattaaaagagattcaaattcgtggagaaattcattcaaatgttgattatacagttgat
ctcttgaatgcctcggatttcagagaaaataagattcatactggttggctggataccaga
atagccatgcgtgttcaagctgagagacctccttggtatatttcagtggttggaggtgct
ctatataaaacaataactaccaatacagccactgtttctgattatgttagctatctcatc
aagggccagattccaccaaagcatatatcccttgtcaattcaactgtttctttgaatata
gaggaaagcaaatatgcaattgagactataaggagtggacatggtagctacagattgcgg
atgaatggatcagttattgaagcaaatgtacaaacactctgtgatggtggcctgttaatg
cagctggatggaaacagccatgtaatttatgctgaagaagaggcaggtggtacacggctt
cttattgatggaaagacctgtttgttacagaatgatcacgatccgtcaaggttgttagct
gagacaccgtgcaaacttcttcgtttcttggttgccgatggtgctcatgttgatgcggat
gtaccatatgcggaagtcgaggttatgaagatgtgcatgcccctcttgtcccctgctgct
ggtgtcattcatgttttgttgtctgagggccaggcgatgcaggctggtgatctgatagca
aggcttgatcttgacgatccttctgctgtgaagagagcagagccatttgacggatttttt
ccggaaatgagccttcctattgctgcttcttgccaagttcacaaaagatgcgctgcaagc
ctgaatgctgctcgcatggtccttgcaggatatgagcacccaatcaacaaagttgtacaa
gatttggtttgctgtctagatactcctgagcttcctttcctacaatgggaagagctcatg
tctgttttagcaactagacttccaagagaccttaaaagtgagctagagggtaaatacagt
gactataagttaactgttgaccatggaaagaacaaggatttccctaccaagacgctaaga
gggataatcgaggaaaatcttgcatgttgttctgagaaggaaaaggctacaaatgagagg
cttgttgagcctcttatgagtctgctgaagtcctatgagggtgggagagaaaaccatgcc
cactttattgtcaagtcccttttcgaggagtatctctctgtcgaggaacttttcagtgat
gacattcagtctgacgtgattgaacgcctgcgcctacaacatagtaaagacctccagaag
gttgtagacattgtgctgtctcaccagggtgtgagaaacaaaactaagctgatattaaca
ctcatggagaaactggtttatccaaacccgtctgcctacagggatcagttgattcgcttt
tcttccctcaatcataaaagatattataagttggcacttaaagctagcgaacttctggaa
caaaccaagcttggtgaactccgcactagcattgcaaggagcctttcagagctggagatg
tttactgaagaaagggtgggtctctccctgcaagagagaacattggccattgatgagagc
atgggggatttagtcactgccccactgccagttgaagatgcacttatttctttgtttgat
tgtactgatcaaactcttcagcaaagagtgattgagacatacatatctcgattgtaccag
cctcatcttgtgaaggatagcgtccagctgaaatataaggaatctggtgttattggcata
tgggaatttgctgaagagcacgctaatataagaaatggacaaaagcccactcttcctgag
aagagatggggtgccatggttattctgaagtcacttgaatctgtgtcaacagccattgga
gttgcgctaaaagatgcatcacactattccagctctgagggtaacataatgcatattgct
ttgttgggtgatgataatcaaattaataaatctgaagacagtggtgataatgatcaagct
caagacaggatagacaagctttccgtgatactgaagcagaatattgtcacagctgatctc
cgtgctgctggtgtaaaggttgttagttgcattgttcaaagagatggagcacgaatgcct
atgcgccgtaccttccttttgtcagatgaaaaactttgttttgaggaagagccgattctc
cggcatgtggagcctcccctttctgcgctccttgagttggataagttgaaagtgaaagga
tacaacgagatgaagtatacaccatctcgcgatcgtcagtggcatatttatacgttgaga
aataccgaaaaccccaaaatgttgcatagggtatttttccgaactcttgtcaggcagcct
actgccggcaacaagtttacatcaggccgtaccagtgatattgaagccggacatgctgag
gaatctctttcatttacatcgagcagcatattaagatcattgatgactgctatagaagaa
ttggagcttcatgcgattaggactggccattcccatatgtatttgtgcatattgagagaa
caaaagcttcttgaccttgttcctgtttcagggagcactgttgtggacgttggccaagat
gaagctactgcatgctcgctcttgaaagaaatggctctaaagatacatgaacttgttggt
gcaagaatgcatcatctttctgtatgccaatgggaagtgaaactcaaattggacagcgat
gggcctgccagtggtacctggagagtcgtaacaactaatgttactagtcatacatgtact
gtggatatctaccgggaggctgaagatacagaagcacagaaactagtataccattctgcc
acatctttatctgctcctttgcatggtgtggcactgaataatccatatcagcctttgagt
gtaattgatctaaaacgttgctctgctaggaacaacagaactacatactgctatgatttt
ccactggcatttgaaactgcggtgcgaaaatcatggtataacattaacactgaaaataaa
cagtgttatgttaaagcaacggagctggtatttgctgacaagaatgggtcgtggggcact
ccattaattcctatggatcgtcctgctgggctcaatgacattgctatggtagcttggatc
ttggacatgtccactcctgaatttcccaatggcaggcagattattgttatcgcaaatgat
attacttttagagcaggatcgtttggcccaagggaagatgcattttttgaatctgttacg
aacctagcttgtgaaaggaaacttcctcttatctacttggcagcaaactctggtgctcgg
attggcatagcagatgaagtgaaatcttgcttccgtgttggctggtctgacgatggcagc
ccggaacgagggtttcagtacatttatctgactgaagaagactatgctcggattagctct
tctgttatagcgcacaagacacagctaactagtggtgaaagtaggtgggttattgattct
gttgtgggcaaggaggatgggctaggtgtggagaatatacatggaagtgctgctattgcc
agtgcttattctagggcgtacaaggagacatttacgcttacatttgtgactggacggact
gttggaataggagcttatcttgctcgacttggcatacggtgtatacagcgtaccgaccag
cccattattctaacagggttttctgccctgaacaagcttcttgggagggaagtgtacagt
tcccatatgcagttgggtggtcccaaaatcatggcaacaaatggtgttgtccatctgact
gttccagatgatcttgaaggagtttctaacatattgaggtggctcagctttgttcctgcc
aagattggtggacctcttcctattacaaaacctttggacccaccagacagacccgttgaa
tacgttcctgaaaatgcatgtgatcctcgtgcggccatcagtggtattgaagatagccac
gggaaatggttgggtggcatgtttgacaaagacagttttgtggagacatttgaaggatgg
gctaagacagttgttactggcagagcaaaacttggagggattcctgtgggtgttatagct
gtggagacacagaccatgatgcagctcatccctgctgatccaggccaacttgattcccat
gagcgatctgttcctcgtgctgggcaagtctggtttccagattctgccactaagacagct
caggcgttgttggacttcaaccgtgaaggattacctctgttcatccttgctaactggaga
ggcttctctggcggtcaaagagatctttttgaaggaatccttcaggctgggtcaacaatc
gttgagaaccttaggacatacaatcagcctgcctttgtatatattcccaaggctgcagag
ttacggggaggggcttgggtcgtggttgatagcaagataaatcccgaccgcatcgagtgc
tatgctgagaggactgcaaaaggcaatgttcttgagcctcaagggttgattgagatcaag
ttcagatctgaggaactccaagactgcatgggtaggcttgacccagaattgattaatctg
aaagcaaaactccaagcagcaaagcatgaaaatggaactctacctgatgtagaatccctt
cagaagagcattgaagctcggaagaaacagttgctgcctttgtacactcaaatcgcgata
aggttcgctgaattgcatgacacttcactcagaatggctgctaaaggcgtgattaagaaa
gttgttgactgggaagattcacggtctttcttctacaagagattacaaaggaggatatct
gaggatgttattgcaaaagaaattagaggtgtaactggtgagcagttttctcaccaatca
gcactcgagctgattaagaaatggtatttagcttctcaggtagctgaggtaggaaacact
gaatgggatgatgacgatgcttttgttgcctggaaggacaaccctgaaaattataaggcg
tatatcaaagaacttagagctcaaaaggtatctcaggtgctcttggatctcggagactcc
agttcggatttacaagccttgccactaggtctttccatgctactagataagatggatccc
tcaaggagagccgactttgttgaggaaatcaggaaggtccttggttga

DBGET integrated database retrieval system