KEGG   Brachypodium distachyon: 100846545Help
Entry
100846545         CDS       T01717                                 

Definition
(RefSeq) protein disulfide-isomerase
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
bdi  Brachypodium distachyon
Pathway
bdi04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100846545
Enzymes [BR:bdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100846545
Chaperones and folding catalysts [BR:bdi03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100846545
Membrane trafficking [BR:bdi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100846545
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100846545
  Exosomal proteins of colorectal cancer cells
   100846545
  Exosomal proteins of bladder cancer cells
   100846545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 Thioredoxin_8 OST3_OST6 AhpC-TSA Redoxin TraF ERp29_N Flagellin_IN
Motif
Other DBs
NCBI-GeneID: 100846545
NCBI-ProteinID: XP_003577736
UniProt: I1IMR6
Position
4
AA seq 518 aa AA seqDB search
MAICNKAWISLLLALAVVLAAPAARAEEAAAAEEAAPAAGEEAVLTLGTDNFDDAIAKHP
FIVVEFYAPWCGHCKSLAPEYEKAAQLLSKHDPPIVLAKVDANDEKNKPLAAKYEIQGFP
TLKIFRNQGKNIQEYKGPREAEGIVDYLKKQVGPASKEIKAPEDASHLEDGKIHIVGVFA
ELSGPEFTNFLEVAEKLRSDYDFGHTVHANHLPRGETAVERPLVRLFKPFDELVVDTKNF
EVSALEAFIEASSTPKVVTFDKNPDNHPYLLKFFQGNSAKVMLFLNFSTGPYESFKSAYY
GAVEDFKDKEVKYLIGDIEASQGALQYFGLNADQAPLILIQDAESKKFLNSNIEADQIVS
WLKEYFDGKLTPFRKSEPIPEANNEPVKVVVADNLDDVVFKSGKNVLIEFYAPWCGHCKK
LAPILDEAATTLQSEADVVIAKMDATANDVPGDFDVQGYPTLYFVTPSGKKVAYDGGRTA
DDIVEYIKKNKETAGQEAAAATEKAADPAATESLKDEL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctgcaacaaggcctggatctcgctgctgctcgcgctcgccgtcgtgctggcc
gcgccggcggccagggcggaggaggcggcggcggcggaagaggccgccccggcggcgggg
gaggaggccgtgctcaccctcggcacggacaacttcgacgacgccatcgccaagcacccc
ttcatcgtcgtcgagttctacgccccatggtgtggacactgcaaaagcctggcaccagag
tatgagaaggcagctcagctgcttagcaagcacgatcctccgatcgttcttgctaaagtt
gatgccaacgacgagaagaacaagccgcttgccgcgaagtacgagatccagggcttcccg
acccttaagatcttcaggaaccaggggaagaacattcaggaatacaagggccccagggag
gctgagggaatcgttgattacctgaagaagcaggtcggtcctgcttccaaggagatcaag
gcaccagaagatgcatcgcaccttgaggacgggaagatccacattgttggtgtctttgcc
gaattgagtggccctgagtttacaaacttcctcgaggttgctgagaagctgcggtctgat
tatgactttggccacactgtgcatgccaaccacctcccacgcggtgagacagcagtagag
aggccattggttaggctattcaagccattcgatgagctcgttgttgacaccaagaatttt
gaggtttctgctttggaggccttcattgaagctagcagcacacctaaagttgttactttc
gacaagaaccctgacaaccatccttacctcctgaaattcttccagggcaattctgccaag
gttatgcttttcttgaacttctccactggaccatatgagtccttcaagtctgcctactat
ggtgctgtagaggacttcaaggacaaggaggtcaagtacctgatcggtgacattgaagcc
agccaaggcgccctccagtactttgggcttaacgcggaccaggcaccccttattctcatc
caggatgccgaatccaagaaatttttgaactcaaacattgaggctgatcaaatcgtttcc
tggttgaaggagtactttgatggtaaactaacaccattcaggaagtctgagccaattcca
gaggctaacaacgagcctgtcaaggttgttgtggctgacaatctcgatgatgtggtcttc
aaatctggcaaaaatgttcttattgaattctatgctccctggtgcggacactgcaagaag
ctagcacccatcttggatgaggctgctaccacccttcaaagcgaagcagatgttgtcatc
gctaagatggacgcaaccgcaaacgacgtgcctggcgatttcgacgtgcagggttacccg
accctgtacttcgtcacccccagcgggaagaaggtcgcgtacgacggtggcaggacggcc
gacgacatcgtcgagtacatcaagaagaacaaggagaccgccggccaggaggcagcggcg
gcgaccgagaaggcggcagaccctgccgccaccgagtcgctcaaggacgagctctga

DBGET integrated database retrieval system