KEGG   Brachypodium distachyon: 100846545Help
Entry
100846545         CDS       T01717                                 

Definition
protein disulfide-isomerase-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
bdi  Brachypodium distachyon
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100846545
Enzymes [BR:bdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100846545
Exosome [BR:bdi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100846545
  Exosomal proteins of colorectal cancer cells
   100846545
  Exosomal proteins of bladder cancer cells
   100846545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 518 aa AA seqDB search
MAICNKAWISLLLALAVVLAAPAARAEEAAAAEEAAPAAGEEAVLTLGTDNFDDAIAKHP
FIVVEFYAPWCGHCKSLAPEYEKAAQLLSKHDPPIVLAKVDANDEKNKPLAAKYEIQGFP
TLKIFRNQGKNIQEYKGPREAEGIVDYLKKQVGPASKEIKAPEDASHLEDGKIHIVGVFA
ELSGPEFTNFLEVAEKLRSDYDFGHTVHANHLPRGETAVERPLVRLFKPFDELVVDTKNF
EVSALEAFIEASSTPKVVTFDKNPDNHPYLLKFFQGNSAKVMLFLNFSTGPYESFKSAYY
GAVEDFKDKEVKYLIGDIEASQGALQYFGLNADQAPLILIQDAESKKFLNSNIEADQIVS
WLKEYFDGKLTPFRKSEPIPEANNEPVKVVVADNLDDVVFKSGKNVLIEFYAPWCGHCKK
LAPILDEAATTLQSEADVVIAKMDATANDVPGDFDVQGYPTLYFVTPSGKKVAYDGGRTA
DDIVEYIKKNKETAGQEAAAATEKAADPAATESLKDEL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctgcaacaaggcctggatctcgctgctgctcgcgctcgccgtcgtgctggcc
gcgccggcggccagggcggaggaggcggcggcggcggaagaggccgccccggcggcgggg
gaggaggccgtgctcaccctcggcacggacaacttcgacgacgccatcgccaagcacccc
ttcatcgtcgtcgagttctacgccccatggtgtggacactgcaaaagcctggcaccagag
tatgagaaggcagctcagctgcttagcaagcacgatcctccgatcgttcttgctaaagtt
gatgccaacgacgagaagaacaagccgcttgccgcgaagtacgagatccagggcttcccg
acccttaagatcttcaggaaccaggggaagaacattcaggaatacaagggccccagggag
gctgagggaatcgttgattacctgaagaagcaggtcggtcctgcttccaaggagatcaag
gcaccagaagatgcatcgcaccttgaggacgggaagatccacattgttggtgtctttgcc
gaattgagtggccctgagtttacaaacttcctcgaggttgctgagaagctgcggtctgat
tatgactttggccacactgtgcatgccaaccacctcccacgcggtgagacagcagtagag
aggccattggttaggctattcaagccattcgatgagctcgttgttgacaccaagaatttt
gaggtttctgctttggaggccttcattgaagctagcagcacacctaaagttgttactttc
gacaagaaccctgacaaccatccttacctcctgaaattcttccagggcaattctgccaag
gttatgcttttcttgaacttctccactggaccatatgagtccttcaagtctgcctactat
ggtgctgtagaggacttcaaggacaaggaggtcaagtacctgatcggtgacattgaagcc
agccaaggcgccctccagtactttgggcttaacgcggaccaggcaccccttattctcatc
caggatgccgaatccaagaaatttttgaactcaaacattgaggctgatcaaatcgtttcc
tggttgaaggagtactttgatggtaaactaacaccattcaggaagtctgagccaattcca
gaggctaacaacgagcctgtcaaggttgttgtggctgacaatctcgatgatgtggtcttc
aaatctggcaaaaatgttcttattgaattctatgctccctggtgcggacactgcaagaag
ctagcacccatcttggatgaggctgctaccacccttcaaagcgaagcagatgttgtcatc
gctaagatggacgcaaccgcaaacgacgtgcctggcgatttcgacgtgcagggttacccg
accctgtacttcgtcacccccagcgggaagaaggtcgcgtacgacggtggcaggacggcc
gacgacatcgtcgagtacatcaagaagaacaaggagaccgccggccaggaggcagcggcg
gcgaccgagaaggcggcagaccctgccgccaccgagtcgctcaaggacgagctctga

DBGET integrated database retrieval system