KEGG   Brachypodium distachyon: 100846646Help
Entry
100846646         CDS       T01717                                 

Definition
ubiquitin carboxyl-terminal hydrolase 3-like
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
bdi  Brachypodium distachyon
Brite
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100846646
Peptidases [BR:bdi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100846646
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 366 aa AA seqDB search
MGAAGSRLEKALGEQFPEGERYFGLENFGNTCYCNSVLQALYFCVPFREQLLEYYANNKG
AGDGEENMLTCLADLFSQISNQKKKTGVIAPKRFIQRLKKQNELFRSYMHQDAHEFLNFL
LNELVDILEKECNATKEPPQNSSLQKNSNGPINGQPNGSHRELDTTWVHKCFQGILTNQT
RCLRCETVTDRDETFLDLSLDIEQNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQK
RMKIKKPPNILVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLINTVDNSDLEYSLFAVLV
HVGSGPNHGHYISLVKSHNHWLFFDDENVEMTDESMVQTFFGSAQEFSGNTDNGYILFYE
SVAKTS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggcggggtccaggctggagaaggcgctgggcgagcagttccccgagggcgag
cgctacttcggcctcgagaacttcggcaacacctgctactgcaacagcgtcttgcaggca
ctttacttctgtgttcctttccgtgagcaattactggagtactatgcaaacaataaaggc
gccggagatggtgaagagaacatgttaacctgcttagctgacctcttctctcagatcagc
aaccagaagaagaagacgggggttattgctccaaagcgttttatacaacgactgaagaaa
cagaatgagcttttccgcagctatatgcaccaggatgctcatgaatttctgaattttttg
ctgaatgagctagttgacattcttgagaaagaatgtaatgccactaaagaacctcctcaa
aattcctccttgcaaaagaattcaaatggccctattaatggtcagcccaatggtagtcac
agagaactggatactacatgggtccacaaatgcttccagggaatactgactaatcaaaca
agatgtctcagatgtgaaaccgtcactgatagagatgaaacatttcttgacctgagcttg
gatatagaacagaatagttcgatcaccagctgtcttaaaaacttcagctcaacagaaact
ttgaatgctgaggataagttcttctgtgacaaatgctgcagtttgcaagaagcacagaaa
agaatgaagataaagaaaccaccaaacatcctggtaattcatctcaagcgcttcaagtac
attgagcagcttggccgctataaaaaactatcataccgagttgttttccctctggagctt
aaactcatcaacactgtcgacaattcagacttggaatattccctttttgctgtgttagtt
catgttggaagtgggccaaatcacggccattacatcagcttggtaaagagccacaaccac
tggttgttctttgatgatgagaatgttgagatgactgatgagtccatggtgcagacattc
tttggctcagcacaggaattcagtggtaacactgataatggttacatactgttctatgaa
agcgtagctaaaacaagttga

DBGET integrated database retrieval system