KEGG   Brachypodium distachyon: 100846863Help
Entry
100846863         CDS       T01717                                 

Definition
beta-hexosaminidase-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bdi  Brachypodium distachyon
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100846863
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100846863
   00603 Glycosphingolipid biosynthesis - globo series
    100846863
   00604 Glycosphingolipid biosynthesis - ganglio series
    100846863
   00511 Other glycan degradation
    100846863
Enzymes [BR:bdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100846863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 596 aa AA seqDB search
MAANNRHGFLAILLLSLLSLAPLRSRAQTTPTTPSSSFPVNVWPKPVSMSWAEPLMAMTF
SPSFRIVVAPSSGEQNPYLVSAAQRYTALLFTERYRPIVRPAANVTAQTALESLTLAVSD
PQAPLQDGVDESYALQIPLAGGAATLTASTAWGAMRGLETFSQLTWRAGSTKAEQLVVAA
GVRVEDRPLYQHRGLMLDTGRTYFPVADILRTIDAMAGNKMNVFHWHITDSQSFPIELPS
EPALAEKGAYGDDMRYTVEDVTRIVEFAMSRGVRVVPEIDAPGHTASWAGAYPEVVSCAG
KFWLPDANDWGSRLAAEPGSGQLNPLKAKTFEVMANVINDVTSLFPDGFYHAGADEVTPG
CWQADPSIQADIANGGTLSQLLEKYVRAVHPHVVSKNRTAVFWEDVLLDATVNVSASLIP
PATTILQTWNNGSNNTKLIVQAGYRAIVSSASFYYLDCGHGDFVGNNAVYDDPRSDYDTN
GGSWCGPFKTWQRVYDYDIAHGLTAEEAKLVIGGEVALWTEQADTTVLDARIWPRASAMA
EALWSGNRDATGKKRYAEATDRLNDWRQRMVGRGVRAEPIQPLWCRTRPGMCDLVR
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaacaacaggcatggcttccttgcaatcctgctcctgtccttgctgagcttg
gcgccgctgcggtcgcgcgcccagacgacgccgacgacgccatcgtcttcgttccccgtc
aatgtgtggcccaagccggtgtccatgtcgtgggcggagccactcatggccatgacgttc
tccccgtcgttccgcatcgtcgtcgcgccttcgtccggggaacaaaacccctacctcgtc
tccgccgcgcagcgctacacggcgctgctcttcaccgagcggtaccggcccatcgtccgg
cccgcggccaacgtcacggcccaaaccgcgctcgagagcctgaccctggccgtgtccgac
ccccaggccccgctccaggacggcgtggacgagtcctacgcgctccagatcccgctcgcg
ggcggcgcggccacgctcacggcgtccacggcctggggcgccatgcgcgggctcgagacg
ttctcgcagctgacgtggagagccgggagcacgaaggcggagcagctggtggttgccgct
ggcgtgcgcgtggaggaccgaccgctgtaccagcaccgcgggctgatgctggacaccggg
aggacgtacttccccgtcgccgacatcctgcggaccatcgacgccatggccggcaacaag
atgaacgtcttccactggcacatcacggactcccagtcgttccccatcgagctcccctcc
gagccggcgctcgccgagaagggcgcctacggggacgacatgcggtacaccgtggaggac
gtcacgcgcatcgtcgagttcgccatgagccgcggcgtccgcgtcgtgcctgagatcgac
gcgccagggcacacggcgtcgtgggccggggcgtacccggaggtggtgtcgtgcgcgggg
aagttctggctgcccgacgcgaacgactggggcagcaggctggcggcggagccgggttcg
ggacagctgaacccgctgaaggccaagacgttcgaggtcatggccaacgtcatcaacgac
gtcacctccctgttcccggacggattctaccacgcgggcgcggacgaggtgaccccgggc
tgctggcaagcggacccatcgatccaggccgacatcgccaacggcggcacgctgagccag
ctcctggaaaagtacgtgcgcgccgtgcacccgcacgtggtgtccaagaaccgcacggcc
gtgttctgggaggatgtgctcctggacgccaccgtgaacgtgagcgcgtcgctgatcccg
ccggcgaccaccatcctgcagacgtggaacaacgggtccaacaacacgaagctgatcgtg
caggccgggtacagggccatcgtctcctcggcgtccttctactacctggactgcggccac
ggcgacttcgtgggtaacaacgcggtgtacgacgacccgaggagcgactacgacaccaat
gggggttcctggtgtgggccgttcaagacgtggcagcgggtgtacgactacgacatcgcg
cacgggctcacggcggaggaggcgaagctggtcatcggcggggaggtggcgctgtggacg
gagcaggccgacacgaccgtgctggacgccaggatttggcccagggcttcggccatggca
gaggcgctgtggtcggggaaccgcgacgcgaccggcaagaaacggtacgccgaggccacg
gaccgactcaacgactggcggcagcgcatggtggggagaggggtccgcgccgagcccatc
cagccgctctggtgccggacacgccccggaatgtgcgacctggttcggtaa

DBGET integrated database retrieval system