KEGG   Borrelia duttonii: BDU_165Help
Entry
BDU_165           CDS       T00768                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bdu  Borrelia duttonii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BDU_165 (malQ)
Enzymes [BR:bdu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BDU_165 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(177972..179456)
Genome map
AA seq 494 aa AA seqDB search
MKRKSGILLSISSLPSQYGIGDLGKGAYEFIDFLASSSQSYWQILLYSLPNCSGVPYLSY
SAFAGNISYIDLNAIDRFIDVDLGIFGCLEDRCIDYDKLKTKNIILRDAALNFLHRATID
EMYAFEKFKKSAAYWLLDFSSFVAFREYYCRFQDPQTFNLLFSKEILKRDPKALMRLRET
LNVEINIQQVLQYFFFSQFKALKRYASNVGIKIISDMPIFMFYDSADVWAHQKYFKLKFD
ASKDKVTGMPSGNLSYKKYLWGNAAYNWKALRKDDYVWWINRIGFMHKYVDIIKFDYFRG
FVSTWEISEREFSVYSSSGQWVKCPGKDFFRNVLSKINDLEIWVEDLLEDRGDAFRLRDY
FNFPETRIMQFAFDFDSKNLCLPHNYIKNCVVYTSTNESNTIRQFINSVDDEHREYIFNY
FNTNEDFVVWDMIRGAMSSVADNVIVSMEDYLDHVVDHKNVSGSMLNDFRILSSDLSTDL
SKKISNITKLYGRI
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaaaagtggaattttgctaagtattagttctttaccgtctcagtatggtatt
ggtgatttggggaagggagcatatgaatttatagattttcttgctagttcgtcgcaaagt
tattggcaaatattgttgtattcacttcctaattgttcaggggttccttatttaagttat
tctgcatttgctggtaatataagttatattgatttaaatgctattgatagatttatcgat
gtagatttaggtatttttggatgtttggaagatagatgtattgattatgataaattgaaa
accaagaatattattttaagagatgcagctttgaattttttgcatagggcgacaattgat
gagatgtatgcatttgaaaaatttaaaaaatctgctgcttattggcttttagatttttca
agttttgttgcttttagggaatattattgcaggttccaagatccacagacctttaatctt
ttatttagtaaagaaatcttaaaaagagatccaaaagctttaatgcgacttagagaaact
cttaatgttgagatcaatattcaacaagtattgcaatatttctttttttcacaatttaaa
gccttaaaaagatatgcaagtaatgttgggattaaaataataagtgatatgcctattttt
atgttttatgattctgctgatgtttgggcacatcaaaaatattttaaattgaaatttgat
gcaagtaaagataaagtaacaggtatgccttctggtaatttgtcttataaaaaatatctt
tggggtaatgcagcttataattggaaagccttaaggaaagatgattatgtgtggtggatt
aatcgtattggttttatgcataaatatgtagatattattaaatttgattattttagagga
tttgtatctacttgggaaatttctgagcgagaattttcagtttatagtagtagtgggcag
tgggtcaaatgtccaggtaaagatttttttagaaatgttttaagtaaaattaatgattta
gaaatttgggttgaagaccttttagaagatcgtggtgatgcttttagattaagagattat
tttaattttccagaaactagaattatgcagtttgcatttgattttgattcaaaaaatttg
tgtttgccacataactatataaagaattgtgttgtctatacaagtactaatgagagtaat
actattcgtcagtttattaattctgtcgatgatgagcatagagagtacatttttaattat
tttaatactaatgaagattttgttgtttgggatatgatacgaggtgcaatgtctagtgtt
gcagataatgtaatagtttcaatggaagattatcttgatcatgtggttgatcataaaaat
gtgtctgggtcaatgcttaatgattttaggatcttgagttctgatttaagtaccgattta
agtaaaaaaataagtaatattacaaaactttatggaagaatttaa

DBGET integrated database retrieval system