KEGG   Borrelia duttonii: BDU_409Help
Entry
BDU_409           CDS       T00768                                 

Gene name
cheB-1
Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bdu  Borrelia duttonii
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bdu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bdu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
438382..439542
Genome map
AA seq 386 aa AA seqDB search
MRITIYVLIIDSSSVNRKAISDIINSSSKLKVIATAANADFALKKLKQDPDVILLGLEKE
TIKDISLIQKKQNINNKIPVIILSSNKDLAINALLQGADDFIIKIDSKLDKIKDKIIDLL
IIYGNKSIKNKIITNINSKPETYTPSQNEKDKKNNLNIINIREHNLKKTNTKYIVTSLNQ
KQIINDQDLKKLKNRKFEMVVIGISTGGPAALKIILSEISKNFPIPIVIVQHMPKGFTTE
FANNLNKICNLTVKETKNNEILQKGCIYISSGGYHTKINKINDNYQIEVFDAENVNGHKP
SIGVLFKSISENVKEKVIALIMTGMGNDGSREIGDIKKAGGVTIAQDEKSSVVFGMPKIA
IEENNIDYIVSIGHVVKLLETILLDG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagaataacaatttacgtgctcattattgattcttcgtctgttaatagaaaggctata
tcggatataataaattcctcatcaaaacttaaagttattgcaactgcagccaatgcagac
tttgcattaaaaaaattaaaacaagacccagatgtaatattactaggcctagaaaaagaa
actatcaaagacatttccctcatacaaaaaaagcaaaatatcaataataaaattcccgtc
attatactatcatctaataaagatcttgcaataaatgctctactacaaggtgctgatgat
ttcataataaaaattgatagtaaattagacaaaataaaagataaaattattgatttactt
ataatttatggaaataagagtataaaaaacaaaatcataaccaatattaattctaaacca
gaaacatacacaccgtcacaaaatgaaaaagataaaaaaaataacctaaatataataaac
ataagagaacataatttaaaaaaaacaaacactaaatacatagtaacaagtcttaatcaa
aaacaaataataaatgaccaagatttaaaaaaacttaaaaatagaaaatttgaaatggta
gttattggaatatccacaggaggccctgcagcattaaaaataattttatcagaaatttca
aaaaactttcctattccaatagtaattgttcaacatatgccaaaaggatttactacagaa
tttgcaaacaatcttaataagatttgtaacttaactgtaaaagaaacaaaaaacaatgaa
atccttcaaaaaggatgcatatatataagttctggaggatatcacacaaaaataaacaaa
ataaacgataattatcaaatagaggtttttgatgcggaaaatgtcaacggacacaaacct
tctataggagtactattcaagtcaatatcagaaaacgtaaaagaaaaagtcatagctctc
ataatgactggaatgggaaatgacggttccagagaaattggagatattaaaaaagctgga
ggcgtaactattgcacaagatgaaaaaagctcagtggtatttggaatgccaaaaattgca
atagaagaaaataatatagactatatagtttcaataggtcatgtggtaaaattattagaa
accatccttcttgatggttaa

DBGET integrated database retrieval system