KEGG   Borrelia duttonii: BDU_59Help
Entry
BDU_59            CDS       T00768                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bdu  Borrelia duttonii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bdu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BDU_59 (tpiA)
   01230 Biosynthesis of amino acids
    BDU_59 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDU_59 (tpiA)
   00051 Fructose and mannose metabolism
    BDU_59 (tpiA)
   00562 Inositol phosphate metabolism
    BDU_59 (tpiA)
Enzymes [BR:bdu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BDU_59 (tpiA)
Exosome [BR:bdu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BDU_59 (tpiA)
  Exosomal proteins of bladder cancer cells
   BDU_59 (tpiA)
  Exosomal proteins of melanoma cells
   BDU_59 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(61387..62151)
Genome map
AA seq 254 aa AA seqDB search
MRKVFLAGNWKMHYTSVEAADVAKQIVDGVYNINNNVVVMVTPTFTSLCKVCRVTKGTNV
LLGAQNMSYENSGARTSEIAPSMLLEFGVDYVILGHSECRTYLGENDEIINKKVLTGLKH
PFKYLILCVGETLEEREKGKTLDVVLNQVRNGLASVYESDLQRIILAYEPVWAIGTGKTA
TKEEAQEVHKAIRLEIQSLYSKSAADNIIIQYGGSVNVDNVEGLMGENDIDGALIGGASL
KADSFLKIINKISK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaggttttcttagcaggaaattggaaaatgcattatacaagtgtagaggccgca
gatgttgctaagcagattgtagatggtgtatacaatattaataataatgtggttgttatg
gtaacacctacatttacgtccctttgtaaagtttgtagagtaactaaaggaaccaatgtt
cttcttggtgctcaaaatatgtcttatgagaatagcggagctagaacaagtgaaattgcg
ccttctatgcttttggaatttggggttgattacgtaatacttggacattctgaatgtaga
acatatcttggcgaaaatgatgaaattataaataagaaagttcttacaggtcttaaacat
ccatttaaatatttaattctctgtgttggagaaactcttgaagagagagaaaaaggtaaa
actttagatgtagttttgaatcaggttagaaatggattagcatctgtatatgaatctgat
cttcagagaataattttagcttatgaacctgtatgggcaattgggacaggaaagacagca
acaaaagaagaagcacaagaagttcataaggcaattagacttgaaattcaatcgttatat
tcaaagtccgcagcagataatattattattcaatatggtggttctgttaatgttgacaat
gtggaaggtttaatgggtgaaaacgatattgatggagcattaattggtggtgcatcttta
aaagcagattcgtttttaaagataattaataaaatatcgaagtag

DBGET integrated database retrieval system