KEGG   Borrelia duttonii: BDU_623Help
Entry
BDU_623           CDS       T00768                                 

Definition
beta-glucosidase, putative (EC:3.2.1.21)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bdu  Borrelia duttonii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bdu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BDU_623
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BDU_623
Enzymes [BR:bdu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BDU_623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(659283..660938)
Genome map
AA seq 551 aa AA seqDB search
MKKIIYIIVFLINNNCFCYDFWSTENKEKLIEQIVSQMNDKELLGQMFMISYPKEKITNF
TLNFIKEKNLGGIKIFGWNAKNLYNLIESINKAQTISQKNRFKIPLFIATDQEGGWTQHI
KLKTSKTIGNLGITATLSPNDAYFTGYHIANELKQLGININFAPITDIYSNEENFIIGPR
TYSNNPQIVSLFALAFYKGQKQAGIISTAKHFPGHGNTVIDSHIKMPIINSDLKEIKTNE
LLPYKILIQENIPMIMSGHLAYPMLTNGKEIPASSSTKIIKEILRQDLKYDNLIITDDLL
MNAVRYQNESIYDTIERIIRTETDILLISLNEDIQNNAYNQLLNLMQKDNTIKENIIKSN
KRILRIKLEYLKEKRNKEELFPKYDNAKEIPTKEAEFFFEQNTLRSITKIKLSKKISKHK
KTLLISPYNTMIKEGKKIFQNSYGYYYNYYPLNSINTTQLKEIKNLIAQYEQVIFNVSTP
ASLEYIKNLKEYKNKISIIVSLTPQHIKQLNWIENIVVVYGTTTLSFKSGFLTLTEDFNP
KGQIPLMNLKN
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattatttatataattgtttttttaattaataataattgtttttgttatgac
ttttggagtacagaaaataaagaaaaactaatagaacaaatagtaagtcaaatgaatgac
aaagaattattgggacaaatgtttatgataagttatccaaaagaaaaaataacaaacttc
accctaaacttcatcaaagaaaaaaatttaggtggaatcaaaatttttggatggaatgca
aaaaatttatacaacttaatagaaagtataaataaagcacaaacaatttctcaaaagaat
agatttaaaattcccttatttatagcaacagatcaagaaggtggatggacacaacatata
aaacttaaaacatcaaaaacaataggaaatcttggaatcacagcaactttatcaccaaat
gatgcctactttactggatatcatatagcaaatgaattaaaacaacttggaattaacata
aattttgccccaataacagatatttacagtaatgaagaaaatttcataataggcccaaga
acatattcaaataatccacaaatcgtatctctatttgcattggctttctataaaggacaa
aaacaagcaggcatcatctcaacagcaaaacattttcccggacatggcaatactgttatt
gattctcatataaaaatgccaataatcaattccgatttaaaagaaattaaaacaaatgaa
ttgctgccatataaaatactaatacaagaaaacattccaatgattatgagcggacactta
gcatatccaatgcttacaaacggaaaagaaatacctgcatcctcatcaactaaaattatc
aaggaaattcttaggcaagacttaaaatacgacaatttaataataacagacgacctacta
atgaatgcagtaagatatcaaaatgaaagcatttatgacacaattgaacgaattattaga
acagaaactgatattttattaatatcattaaatgaagatatacaaaataatgcttacaat
caactattaaacctcatgcaaaaagacaatacaataaaagaaaacattattaaatctaac
aaaagaatacttagaataaaattagaatatctaaaagaaaaaagaaacaaagaagaactt
ttcccaaaatatgacaatgctaaagaaatacctactaaagaagctgaatttttttttgaa
caaaatacattaagaagtataacaaaaataaaactatcaaaaaaaatatcaaagcataaa
aaaacgctattaatatcaccttataatacaatgattaaagaaggtaaaaaaatatttcaa
aatagttatggctattattataattattatccactaaatagcataaataccacacaatta
aaagaaataaaaaatttaattgcacaatatgaacaagttatttttaatgtatcaacacct
gctagtttagagtacataaaaaatttaaaagaatataaaaataaaataagcatcattgta
tctcttaccccccaacacattaaacaactgaactggatagaaaacatagtagtagtatat
ggaactacaacactatcatttaaatctggatttttaactttaacagaagattttaatcca
aaaggacaaatacctttaatgaatctcaagaattaa

DBGET integrated database retrieval system