KEGG   Borrelia duttonii: BDU_636Help
Entry
BDU_636           CDS       T00768                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bdu  Borrelia duttonii
Pathway
bdu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bdu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BDU_636 (recD)
Enzymes [BR:bdu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BDU_636 (recD)
DNA repair and recombination proteins [BR:bdu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BDU_636 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Viral_helicase1 UvrD_C_2 AAA_11 Helicase_RecD DUF2075 PhoH T2SSE AAA_22 RsgA_GTPase AAA_5 AAA AAA_16 DEAD AAA_28 RNA_helicase Zeta_toxin PRR18
Motif
Other DBs
NCBI-ProteinID: ACH93565
UniProt: B5RMH9
Position
complement(675544..677370)
Genome map
AA seq 608 aa AA seqDB search
MRNYLVLREFLQEEQKNYLNPELKIYEIIEILNINVEQYYKSHLLTQKIQNDKYEELTIF
LIFIFNYFSKGHLRANIDLLIQDIQNTIDCALLELEEENQHYQKSTHILQELTKFSKETK
IKEMILYLEKNNIIKNYNQNEKITTPLILENNIYIYTQKNFREEEELIKQIDKRLKNNKT
EISDDRIQNIMDHLNITNLSKEQINSIKKALKSNFFILSGGPGTGKTTTINYILKAIDIH
LDCKQNVALVAPTGKASQKLKSSIKESFKNLETQHSTIQKLLKMSFINKDDKYDENNPLE
FEIIIIDEASMIDANTFLRLLKALKINTKIIITGDKNQLPSIAGGNVYSSLTKIKKINDD
SVEILKKNFRSNDEINLLAKAIYKEDMDLIETQFNDSKNIILKNLNKINIENELLKHTKK
LYNNIPNFNLNSLNDKEIESIIHTLLSNTILCSKNLGKFGTQKINEIIKFYLKKLYGNLI
GQIILITQNDYKNDLFNGERGILFKENSKIYALFKRENEKYKKINFNLINKYELSFATTI
HKSQGSEYQHIQIIIENHPFLTKELLYTAITRARESIEIISNKEIIKNVSLKKINRDSKI
TEYINTLK
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgagaaattatttagtcttaagagaattcctacaagaagagcaaaaaaactacttaaat
ccagaactcaaaatttatgaaataattgaaattttaaatataaatgtagaacaatattac
aaatcacatttacttacacaaaaaatacaaaatgacaaatatgaagaacttaccattttt
ttaatattcatatttaattacttctctaaaggacacttaagagcaaatattgatctacta
atacaagatatccaaaacacaatcgactgtgctttactcgaactagaagaagaaaatcaa
cactatcaaaaatcaacacacatattacaagaacttacaaaattttcaaaagaaactaaa
ataaaagaaatgatattatatttagaaaaaaataatataataaaaaattacaatcaaaat
gaaaaaataacaactcctttaatattagaaaataatatttacatttacactcaaaaaaat
tttagagaagaagaagaattaataaaacaaatagacaaaagacttaagaacaataaaaca
gaaataagtgatgatagaatacagaacatcatggatcacttaaatattacaaatttaagt
aaagaacaaataaactcaattaaaaaagctttaaaaagtaatttttttatattaagtggt
ggaccaggaacaggcaaaacaacaacaattaactatattctcaaagcaattgacatacat
ttagattgtaaacaaaacgtagctcttgtagcaccaaccggaaaagcaagtcaaaaattg
aaatcaagtattaaagaatcatttaaaaaccttgaaacacaacatagcacaatacaaaaa
ctattaaaaatgtcattcataaataaagacgacaaatatgatgagaataatcctttagaa
ttcgaaataattataatagatgaagcatctatgatagatgcaaatacctttttaagatta
ttaaaagcattaaagataaatacaaaaattataataacaggagataaaaaccaacttcca
tcaatagctggaggaaatgtgtattccagccttacaaaaataaaaaaaataaatgatgat
agtgtagaaatactgaaaaaaaattttagaagcaatgatgaaataaatttattagccaaa
gcaatatataaagaagatatggacttaattgaaactcaatttaatgatagcaaaaacata
attctaaaaaacctaaataaaataaatattgaaaatgaattactaaaacatacaaaaaaa
ttatacaataacattcccaatttcaatcttaactcgttaaatgacaaagaaattgaatca
ataattcatacactgcttagtaacacaattttatgttcaaaaaatcttggaaaatttggc
acacaaaaaataaatgaaataattaaattttatttaaaaaaattatatggaaatttaatt
ggacaaataattttaattactcaaaatgattataaaaatgacctatttaatggggagaga
ggaatactttttaaagaaaattctaaaatttatgctctatttaaaagagaaaatgaaaaa
tacaaaaaaataaactttaacttaataaataaatatgagctgagctttgcaacgacaata
cataaaagtcagggctctgaatatcaacacatacaaattataatagaaaatcaccctttc
ttaacaaaagaattactctacactgcaataacaagagctagagaaagtatagaaataata
tcaaacaaagagataattaaaaatgtcagtttaaagaaaatcaatagagactccaaaatt
acagaatacataaacacgttaaaataa

DBGET integrated database retrieval system