KEGG   Borrelia duttonii: BDU_661Help
Entry
BDU_661           CDS       T00768                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bdu  Borrelia duttonii
Pathway
bdu00010  Glycolysis / Gluconeogenesis
bdu00260  Glycine, serine and threonine metabolism
bdu00680  Methane metabolism
bdu01100  Metabolic pathways
bdu01110  Biosynthesis of secondary metabolites
bdu01120  Microbial metabolism in diverse environments
bdu01130  Biosynthesis of antibiotics
bdu01200  Carbon metabolism
bdu01230  Biosynthesis of amino acids
Module
bdu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bdu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BDU_661 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BDU_661 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BDU_661 (gpmA)
Enzymes [BR:bdu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BDU_661 (gpmA)
Membrane trafficking [BR:bdu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BDU_661 (gpmA)
Exosome [BR:bdu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BDU_661 (gpmA)
  Exosomal proteins of melanoma cells
   BDU_661 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACH93590
UniProt: B5RMK4
Position
709250..710002
Genome map
AA seq 250 aa AA seqDB search
MYKLVLVRHGESEWNKENLFTGWTDVKLSEKGVSEACEGGRILKEEGYSFDIAFSSMLVR
ANDTLNIILCELGQSYIDVEKSWRLNERHYGALQGLNKAETAEKYGEDKVLIWRRSYNVP
PMPLDESDKRHPIHDSRYKNIPKSELPSTECLKDTVARVIPYWTDKIAKAILEGKRVIVA
AHGNSLRALVKYLDNMSEEDILKLNIPTGIPLVYELDKNLKPVKHYYLGDEDKIKAAMES
VANQGKKIDR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtataagttagttttagtgaggcatggtgagagtgaatggaataaggaaaatcttttt
acaggatggactgatgttaaactttctgagaagggtgtttctgaagcttgtgagggtggt
agaatattgaaagaggaaggttattcttttgatattgcttttagctcaatgttagtaaga
gctaatgatactttaaatattattttgtgtgaattgggtcaatcgtatattgatgtagaa
aaatcttggcgacttaatgagagacattatggggcattgcaagggttaaataaggctgaa
acggctgaaaagtatggcgaagataaagttctcatttggagacgtagttataatgttcct
cctatgcctttggatgagtctgataagcgtcatcctattcatgattcaagatataaaaat
attcctaaaagtgaacttccttcaaccgagtgtttaaaagatactgttgcaagagttata
ccatattggacagataaaattgctaaggctattcttgaaggaaaaagagttattgttgct
gctcatggtaattctttaagggctcttgttaaatatcttgataatatgagtgaagaagat
attttaaagctcaatattccaacgggtattcctttagtttatgagcttgataaaaattta
aaacccgttaaacattactatttgggtgatgaagataaaattaaggcagctatggaatct
gttgctaatcaaggtaaaaaaatagatagataa

DBGET integrated database retrieval system