KEGG   Borrelia duttonii: BDU_661Help
Entry
BDU_661           CDS       T00768                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bdu  Borrelia duttonii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:bdu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bdu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bdu00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:bdu00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bdu00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
709250..710002
Genome map
AA seq 250 aa AA seqDB search
MYKLVLVRHGESEWNKENLFTGWTDVKLSEKGVSEACEGGRILKEEGYSFDIAFSSMLVR
ANDTLNIILCELGQSYIDVEKSWRLNERHYGALQGLNKAETAEKYGEDKVLIWRRSYNVP
PMPLDESDKRHPIHDSRYKNIPKSELPSTECLKDTVARVIPYWTDKIAKAILEGKRVIVA
AHGNSLRALVKYLDNMSEEDILKLNIPTGIPLVYELDKNLKPVKHYYLGDEDKIKAAMES
VANQGKKIDR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtataagttagttttagtgaggcatggtgagagtgaatggaataaggaaaatcttttt
acaggatggactgatgttaaactttctgagaagggtgtttctgaagcttgtgagggtggt
agaatattgaaagaggaaggttattcttttgatattgcttttagctcaatgttagtaaga
gctaatgatactttaaatattattttgtgtgaattgggtcaatcgtatattgatgtagaa
aaatcttggcgacttaatgagagacattatggggcattgcaagggttaaataaggctgaa
acggctgaaaagtatggcgaagataaagttctcatttggagacgtagttataatgttcct
cctatgcctttggatgagtctgataagcgtcatcctattcatgattcaagatataaaaat
attcctaaaagtgaacttccttcaaccgagtgtttaaaagatactgttgcaagagttata
ccatattggacagataaaattgctaaggctattcttgaaggaaaaagagttattgttgct
gctcatggtaattctttaagggctcttgttaaatatcttgataatatgagtgaagaagat
attttaaagctcaatattccaacgggtattcctttagtttatgagcttgataaaaattta
aaacccgttaaacattactatttgggtgatgaagataaaattaaggcagctatggaatct
gttgctaatcaaggtaaaaaaatagatagataa

DBGET integrated database retrieval system