KEGG   Bacillus endophyticus: BEH_19265Help
Entry
BEH_19265         CDS       T03983                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
beo  Bacillus endophyticus
Pathway
beo00071  Fatty acid degradation
beo00072  Synthesis and degradation of ketone bodies
beo00280  Valine, leucine and isoleucine degradation
beo00310  Lysine degradation
beo00362  Benzoate degradation
beo00380  Tryptophan metabolism
beo00620  Pyruvate metabolism
beo00630  Glyoxylate and dicarboxylate metabolism
beo00640  Propanoate metabolism
beo00650  Butanoate metabolism
beo00900  Terpenoid backbone biosynthesis
beo01100  Metabolic pathways
beo01110  Biosynthesis of secondary metabolites
beo01120  Microbial metabolism in diverse environments
beo01130  Biosynthesis of antibiotics
beo01200  Carbon metabolism
beo01212  Fatty acid metabolism
beo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:beo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BEH_19265
   00630 Glyoxylate and dicarboxylate metabolism
    BEH_19265
   00640 Propanoate metabolism
    BEH_19265
   00650 Butanoate metabolism
    BEH_19265
  Lipid metabolism
   00071 Fatty acid degradation
    BEH_19265
   00072 Synthesis and degradation of ketone bodies
    BEH_19265
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BEH_19265
   00310 Lysine degradation
    BEH_19265
   00380 Tryptophan metabolism
    BEH_19265
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BEH_19265
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BEH_19265
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BEH_19265
Enzymes [BR:beo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BEH_19265
Exosome [BR:beo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BEH_19265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AKO94041
UniProt: A0A0H4KMF3
Position
complement(3916669..3917856)
Genome map
AA seq 395 aa AA seqDB search
MVQQEVVIVSAVRTAIGAFGGSLQNVSAPTLGSIVIKEALQKAGVKAEDVDEVIMGNVLQ
AGLGQNPARQAALKAGLPQEVAALTINKVCGSGLKAVHLATQAIFAGDAEIVVAGGMENM
SQAPYLLKNARNGFKMGDQKVVDSMIADGLWCAFNDYHMGVTAENLCEKYEISRQEQDEF
AASSQQKAEKAITSGRFKDEIVPVEIPQRKGDPIVFAEDEFPRKGTTAEGLGKLRPAFKK
DGSVTAGNASGINDGAAALVVMSREKADELGLQPLVRIKANASAGVDPSIMGIGPVASVQ
KVLKKAELDLDQFDLIEANEAFAAQSIAVDRELSFNKEKLNVNGGAISLGHPIGASGARI
LVSLIHEMTKREANLGLATLCIGGGQGVATVVERV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtccaacaagaagtggttattgtaagcgcagtaagaacagcaattggtgctttcggg
gggagcttacaaaatgtatccgctccaactttggggagtattgtgattaaagaagcgtta
caaaaagcaggggtcaaagcagaagatgtagacgaagttatcatggggaacgtgctacag
gctggcttagggcaaaacccagcacgtcaagctgcgctaaaggcaggacttccacaagaa
gtggcagcacttaccattaacaaagtttgtggctcaggtttgaaagcagttcacttagca
acgcaggctatttttgcaggggatgcagaaatcgttgttgcaggtggaatggaaaatatg
agtcaagctccatatttattaaaaaatgcacgtaatggattcaaaatgggagatcaaaaa
gttgttgatagcatgatcgcagacggtttatggtgcgctttcaacgattatcatatgggt
gttacagctgagaatttgtgcgaaaagtatgaaatctctagacaagagcaagatgaattt
gcagcaagcagccagcaaaaagctgaaaaagctattacttcaggtcgtttcaaagacgaa
attgtgcctgttgaaattccacagcgcaaaggagatcctatcgtatttgcagaagacgag
tttcctcgtaaaggaacaactgcggaaggtcttggcaaattaagaccagctttcaaaaaa
gatggatcagttacagcgggtaatgcgtcaggaattaatgatggagctgcagctcttgtt
gtaatgagtcgcgagaaagcagatgagcttggtcttcagccacttgttcgcattaaagcg
aatgcaagtgcaggcgtagatccaagtattatgggtattggccctgttgcatctgtccaa
aaggttctaaagaaagcagaacttgatcttgatcaatttgatttaattgaagcaaatgaa
gcatttgcggcacagtcaattgctgttgatcgtgagctttcttttaataaagaaaagcta
aacgtaaatggaggggctatttcacttggccatccaattggagcaagcggtgcacgtatt
ctagtgtcccttattcatgaaatgacaaagcgtgaagcaaacctaggtttagcaacgtta
tgtattggcggaggtcaaggcgtagcaacggttgttgaacgcgtataa

DBGET integrated database retrieval system