KEGG   Babesia equi: BEWA_008200Help
Entry
BEWA_008200       CDS       T02820                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
beq  Babesia equi
Brite
Enzymes [BR:beq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     BEWA_008200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 542 aa AA seqDB search
MKTVMEDIFSVELHPCETIEDYQNDKDGYKPLFTHHFFNPEYRNDSIKWVKYDIYYLVDT
FEIFIKVKGQLVNSCNRENIQEALSTVYKSVFKNIPEYTLIKDEQTFIDILLHKSSGTYK
FIPPGRMVMENSIDDYSTFQLRYCTFKDEITEKDVGEVDEQDPGSIYMKSTLSKQIYFYD
NSKSDKIDLSRETIEDLSKDGSFNNSVINEILESKLALRSQNSPKVKLSVQECVTDYSIP
SNFKVLHRRIEWFYHWFIDGVSDITYDHRWVVLIPLVLKRNRKMHKPSETNSLQSALTSN
EDFERRRIEQEYDIQTHITKQDLGAISMFNSESSGDDKDAYTISIVGMVTTYSYFTISGN
RLRISQFMIMPNYSGKGFGLMVLEMIYRMAILDKNVREVSVEDPTSTFSILRYIVIMKMC
FDSAHISPNMLYSDIEEPAYASVKEWVVKVCKESKYNASRIVEILQLTVILHPISRLPYT
LTKTAPGTASDHYLKLSNGSEAYVNYVANLMKRIRSEEIRRLGKVDHFNLGTSSINAVNH
VG
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggtgatggaagacatattttctgtagaattacatccatgtgaaacgatagaa
gactaccaaaatgataaggatggctacaagcctcttttcacacatcatttctttaatcca
gaatacaggaatgattcaatcaagtgggtcaagtacgacatctactacctcgtggatacg
ttcgagattttcataaaggttaagggtcaattggttaattcatgtaacagagaaaatatc
caagaagctctatcaaccgtatacaagtctgtttttaaaaacattcccgagtacacactg
attaaagatgaacagacattcattgatattctattacataaatcctccggaacctacaaa
ttcattccacctggaagaatggtaatggaaaatagcattgatgattattctacatttcaa
ttacgatactgtacattcaaagatgagataacagagaaggatgtaggagaggtagatgaa
caagaccctggttctatttatatgaaaagtacactatctaaacaaatttacttttacgat
aactctaaatctgacaaaatcgacttatcaagggaaacaattgaggatttgtctaaggat
ggaagttttaataactctgtaattaatgaaattctagaaagtaaactagctcttcgttca
caaaattctccaaaggtcaaattgtccgtacaagagtgtgtgaccgattattctataccc
agtaacttcaaggtgttgcatagacgaatagaatggttctatcattggtttattgatgga
gtttcggacattacatatgatcatagatgggtagttttaattcctctggtgctaaaaaga
aatcggaaaatgcataaaccatcagagactaactcattacagagtgcattgacttcaaat
gaagattttgaaaggagaaggatagaacaggagtatgatattcaaacacatataaccaag
caagatcttggggccatatctatgttcaactcagaaagttctggagatgacaaagacgca
tacacgatctccatagtaggaatggtgactacatattcatattttacgattagtgggaat
cgactgagaatatcccaattcatgataatgccaaattacagtggtaaagggtttggtcta
atggttctggaaatgatttatagaatggcaattctagacaaaaacgtgagagaagtatca
gtagaagatccgacaagcacattctccatcttaagatacattgtaatcatgaaaatgtgc
tttgattcggcacacatatcaccaaatatgttgtacagcgatatagaagaaccagcatat
gcctctgtgaaagaatgggtcgtaaaagtgtgtaaagaaagtaaatacaatgcatccagg
atagtagagattcttcaattaacagtcattcttcaccccatttcgcgtcttccttacaca
cttaccaagacagcaccaggtacggcttcggatcactatttaaagttgtcaaatggatcc
gaagcttatgtaaactatgtagccaacctaatgaaaaggattcggtccgaagaaatcaga
aggcttggtaaagtggatcatttcaatctaggaacttcttctataaatgcagttaatcat
gtaggctaa

DBGET integrated database retrieval system