KEGG   Babesia equi: BEWA_011400Help
Entry
BEWA_011400       CDS       T02820                                 

Definition
glutamate dehydrogenase, putative (EC:1.4.1.2)
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
beq  Babesia equi
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:beq00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BEWA_011400
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BEWA_011400
   00330 Arginine and proline metabolism
    BEWA_011400
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BEWA_011400
Enzymes [BR:beq01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     BEWA_011400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1029 aa AA seqDB search
MITSMSNFSNRLAVNDGLSNVHDRTDTVILSDQYSEQFEAVKNIVRGLMTFTEEKIDEVI
YHYYNTLGLNEYYFQTSTPELIAHNMISVMSAKILHENSGSKFFPLIEQVTDNNVFIITR
TSVLNRKSSENYSVERNIESKYFNLADTTKPFWRMQCFRSTSSIFSESDNTFDRLKTYFL
QKPVFACTNPDPSELDLSKLLDKDFYINKRNTITEQIYHNLNKKLVESKTGLGLEFHLEP
RQNDVYRLDIAFRRGYFHDDLYSRIGDTITLYDLYSKSKYIDPLSNNVCIMTAFLTSLPE
AQCTLESPLEQRISNLVEDIKLTTIIPESKITHLTLDRTLTIHEAAYAYCVSIFIQHFSG
SVGPFVVTVDNLAKNQHVSPSELHEIKSKLKIQPYTSFRIYSAISQNIDIIKALYEEFKM
LHHPQDNKGGLTFSENSPLSKQIKQLDNQEHVDILSYFLKFNKYTLRTNFFKPDKISLSF
RFDSTFLKKSDYPKIPYAIVLIIGPHFMGFHIRFSEISRGGIRVVQSFSQEAYTRNKLQI
FDEAYNLSFTQSLKNKDIPEGGSKGVILLDKTNTKELADNYTRVSFMCYIDGILDLMLPD
EHMVDRLNKNEIYFVGPDEHTGTGGLMDWAAEYAKLRGCDYWRAFTTGKGPDMGGIPHDV
YGMTTASIESFVLELFKKYGLDESNVTRFLTGGPDGDLGSNALLASNTKTLSVVDKSGVL
HDPEGLNIAELRRLASLRKEGKPTCSMMYNPQLLSKRGFMVPEEAIDITLPDGTLVKNGY
KFRDSFHLTPYAAAHLFNPCGGRPSSITPFNVNEIFNENNKCFFKFVVEGSNVYITQNAR
RILESKGVVVFKDASTNKGGVTSSSYEVLLALVLDDKTFKDVAVEIDGYCPDFRKEYIEE
IIDIIKRNARNEFHALWNEGIRTGKPRCDLTDILSSKINNLKQSIMESDTLWNDSSFVDY
ILKRSIPKSLLRLISIEEIKKRLPERYLRAFFATNIASIFYYSQQFSEETSVFGFYDYIS
RMKGSINDS
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atgataacatctatgtcaaatttttctaacagactggctgtcaatgacggtctctcaaat
gtccatgacaggactgatacggtgatcctgagtgatcaatattccgaacagtttgaagca
gtgaaaaatattgtacgcggtttgatgacattcactgaagaaaaaattgatgaagtcata
tatcattattataatacgctaggtttaaatgaatattattttcagacttcgactccggag
ttgatagctcacaatatgatctcagtaatgtctgcaaaaattttgcacgaaaattcggga
tcaaaattttttccactaatagaacaggtgacagataataatgtgtttattattacaagg
acatctgtcttaaatcggaaatcttctgaaaattattccgtagagcggaatattgaaagt
aaatatttcaatcttgcagatactacgaagcccttttggagaatgcagtgttttagatct
actagctcaatatttagtgagtctgataacacatttgatagattgaagacttattttttg
caaaagcctgtttttgcatgtaccaacccggatccttctgagttagatttgagcaagtta
ttggataaagatttttatattaacaaaaggaatactataactgaacaaatttatcataat
ttgaataaaaaattggtggaatccaaaactggccttggattagaatttcatcttgagcct
aggcaaaatgacgtttatcgcttagatatagctttcaggagaggatattttcatgatgac
ctttattcgagaataggtgataccataacactttatgatctttattctaagtccaaatat
attgatcctttatctaataatgtatgcatcatgacggcatttttgacatctttacctgaa
gcgcaatgtacacttgaatccccattggaacaaagaatatcaaatttggtagaagatata
aaattgacaactataattcctgaatcaaagataacgcatctaacgctggatagaactttg
accattcatgaagctgcgtatgcttactgtgtttcgatattcattcagcattttagcggt
agtgtcggtccatttgttgttactgttgataacttggcgaaaaatcaacatgtatcacca
tcggaattacatgaaattaaatcgaaactgaaaattcagccttataccagttttagaatt
tattctgcaatatctcaaaatatagatataataaaggccttatatgaggaatttaagatg
ttacaccatccacaagataataaaggtggtttaacattttctgagaattcaccactttct
aaacagatcaaacagctggataatcaggagcatgtagatattttgtcatattttctaaaa
ttcaataaatatactttgaggacaaattttttcaaaccagataaaattagcctatcgttt
cgtttcgattcaacatttttgaaaaaatcagattacccaaagattccttatgctatagtt
ctgataataggaccacattttatgggatttcatattcgtttcagtgagatatctagaggt
gggattcgtgttgtacagtcgttttcacaagaggcttatactcgcaataaattgcaaatt
tttgacgaggcatacaatttgtcatttacacaaagtcttaaaaataaagatattccagaa
ggtggatcaaagggagttatattattggataagaccaacactaaagaactcgcagataat
tatactcgtgtgagctttatgtgttatatcgacggtatattagatttaatgttaccggat
gaacatatggtcgaccgtttgaacaaaaatgaaatttatttcgttggtccggatgaacat
actggcacaggtggacttatggattgggcggcagagtatgcaaagctaaggggctgtgat
tactggagggcttttactacaggaaagggtcctgatatgggtggtataccacatgatgtt
tatggaatgacaacagctagtatagaatcttttgtcctggagttattcaaaaaatatggt
ctagacgaatccaatgtgacacgatttttaactggtggtccggatggtgatttaggaagc
aatgcattgttagctagtaacacaaaaacactatccgttgttgataaaagtggtgttttg
catgatcctgaagggctaaacatagctgagttgcgtcgtttagcttctttgaggaaggaa
ggaaaaccaacttgctctatgatgtataatccacagctactttctaaaagaggattcatg
gttcctgaagaagcgatagacataactttacctgatggaactctcgttaaaaatgggtat
aaattcagagatagcttccatttaactccatacgctgccgcacatttgttcaatccatgc
ggtggtagaccttcatcgattactccatttaatgtgaatgagatattcaacgaaaataac
aaatgttttttcaagttcgttgtagagggatctaatgtttatattactcaaaatgcgagg
agaattttagaaagcaaaggggttgttgtctttaaggatgcatctaccaacaagggaggt
gtaacaagcagtagttatgaagtcctgcttgcgttggttttggatgacaaaacgtttaaa
gatgtggctgtagagattgatggctactgtcctgattttagaaaagaatatatagaagaa
attatcgatatcataaaacgtaatgcaagaaatgagtttcatgcgttgtggaatgagggc
attaggactgggaaaccaaggtgtgatttaacagatattttgtccagcaaaataaataac
cttaagcaaagtattatggaatcagatacgctatggaacgattcgtctttcgtagattat
atattgaaaagatcaataccaaagtccctacttagactgataagtatcgaggaaatcaaa
aaaagacttccagaacgctatttgcgcgcgttctttgcaacaaacatagcttcaatattc
tactatagccaacaattttcagaagaaacatccgtttttgggttttacgattatattagt
agaatgaaaggatccattaacgatagctga

DBGET integrated database retrieval system