KEGG   Babesia equi: BEWA_023290Help
Entry
BEWA_023290       CDS       T02820                                 

Definition
NADH-cytochrome B5 reductase, putative (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
beq  Babesia equi
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:beq00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 298 aa AA seqDB search
MYYEPLDLNLYLEKEAGYIGRDCSTNNEICEIKLVKRTRVSPTAHLFVFGYPQEIKGAVE
VGAFGHFLFSGHLLESATPGFWNAVKLENGEKEVKRKYTPIYIDAAKRQIHFLIRIYGPC
EEFPDGGKFTRFLDKLEVQDSLKVIPWKPKYRLVEEAVIRVLGRRLEYKVLNLIAAGTGI
TPFVRLLTHYQNTPVSVNLIYCNRSIEEIMLKELFDTLTCSNSNIRVRYLVYSRKDYSES
GSIADSPSISRCIINKEIISEVLEVAEKSVTLYCGPPKFCDLVKELLASLNFTNSHVI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtactatgagcctctagacctcaacctttatctggagaaggaggctggatatatcggc
agagattgctccacaaataacgaaatttgtgagattaaactcgtcaaaaggacaagggtc
tcaccaactgcccatctgtttgtctttggctaccctcaagagatcaaaggcgccgttgaa
gtcggtgcttttgggcattttctattctctggacatcttttagagtcggcgaccccgggg
ttctggaacgcggtaaagctggaaaatggcgaaaaggaggtgaagcgaaagtacacgcca
atttacattgatgctgcaaagagacaaatacactttctcattcgaatatacggtccgtgt
gaagagttcccagacggtggcaaatttacaaggtttctggacaaactagaggtccaggat
agcctcaaagtgataccctggaagccaaagtacaggctcgttgaagaggctgtgattagg
gtgctgggaagacgtcttgaatacaaagttctgaatctaatagccgctggtacagggata
acaccttttgttagactactaacacactaccaaaatacacctgtgtctgttaatctcata
tactgcaatcggtccattgaggagattatgctaaaggagcttttcgatactttgacctgc
tccaattcaaacataagagtcagatatctcgtctattcacgcaaagactactctgaatct
ggaagcattgcggattcacccagcatttcaaggtgcattataaacaaggagataatttca
gaggtcctggaagtggctgaaaaatccgtaactttatactgtggacctccaaagttttgt
gatttagtcaaagagctgctcgccagtttaaactttacaaactcccacgtaatataa

DBGET integrated database retrieval system