KEGG   Babesia equi: BEWA_029360Help
Entry
BEWA_029360       CDS       T02820                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
beq  Babesia equi
Brite
Enzymes [BR:beq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     BEWA_029360
Transcription machinery [BR:beq03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     BEWA_029360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 685 aa AA seqDB search
MDSVGPGSATAGRRSDPRPYWEVRRFCWVPYALVLHSQFQMRAKSLDETRDVDSGLPDYD
DEAMPLNLIPDGSGKFSELNLDESVISNVAVGESIASIVRTIVNLYLMDCKNRPDPFQPQ
LEPRGSPKGSMETESLFLNGSDVTQLVNSSLERVPKVKRKDLVELRKVLADSDEEGVNIL
VKSVCAIISYQQLLTPAARREFNKEHMQQWIKSQDAEAFVDKDYEVVYGKWKKYLKKQMP
MGISVCDYFSTDLLKSVLLINADRIRQELEKTAFKFHPDMILILLCKECGFTDEQANTIG
TMSSARGYQIQSLLPSETGLGFLHRDAGGAKEEDLGIISFECITNDREPGHLIKLVTVKN
IFSRQLPKMPREYIVRLVFDRNHYTFCLLKKGQVIGGICFRPYFEQRFAEIAFLAVKSTE
QIKGYGTRIMNHLKEHVKKSGIEYFLTYADNFAIGYFRKQGFSQKITMPRERWFGYIKDY
DGGTLMECYISPNINYLRLSEMLSRQKAVVMQCIEAIKPLKVYDGLTVFAESSKDSQKKP
RCTLVPSEIPGLIEAGWTEAQESQQSKQSDPNAPADTEPQKKSLKASILELLNNLNKQQS
VWPFRKPVKQSEAPDYYEIITQPTDISTMKRKAKLGEYKTKEQFGEELKRMFDNCRLYNT
SHTIYYKYANELQAFIWPQYENIQE
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggatagtgttggccctggtagtgccacggctggtcgcaggtctgaccctcgcccctac
tgggaggttaggcgtttctgctgggttccctacgctctggtgcttcactcacaattccag
atgcgtgccaaatcgttggacgagactagagacgtcgattctgggcttccggactacgat
gacgaggccatgcctctaaatctcattcctgatggcagcggaaagttttctgagttaaat
ctcgacgagtcagtaatttcaaacgttgcagtgggtgaatctatcgcttcaatcgtcagg
acaatcgtaaatctctacctgatggactgcaagaaccgtcctgacccttttcagccgcag
ttggagccgcgaggctctccaaagggttccatggagactgaaagtctgtttttgaatggg
tctgacgttacgcagctcgtgaactcgtccctggagcgagttccaaaggtaaagagaaag
gacctggtggaactccgcaaagtcctggcggactccgacgaggaaggcgtgaacatcctc
gtcaagagcgtctgtgccatcataagctaccagcagctcctcacaccggccgctcgccga
gaatttaacaaggagcatatgcagcagtggatcaaatcgcaagatgccgaggcttttgtg
gacaaggactacgaagttgtctatgggaagtggaagaagtatctcaagaagcaaatgccc
atgggaatatcggtatgtgactacttttcgactgacttgctcaagtctgtgctactcatc
aacgctgacaggattagacaagagctggagaagaccgcattcaagttccaccccgatatg
atactcattttgctctgcaaggagtgtggattcacagatgaacaggccaatacgattgga
acaatgagcagtgcccgaggctaccagatccagtcgttgctgccctcggaaacaggtctc
ggtttcctacacagagacgctggtggagcaaaggaggaagatcttggcatcatttcattc
gagtgtattacaaatgaccgagaaccaggacaccttatcaagttggtaactgtaaagaac
attttttcaagacaactcccaaaaatgcccagagagtacattgtgagacttgtgtttgac
aggaatcactacacattttgtttgctcaaaaaaggacaagtgattgggggcatttgcttc
aggccttactttgaacaacgatttgcagagattgcattcttggccgtaaaatcaacagaa
caaattaaaggatacggaacccgtattatgaaccatttgaaagaacacgtaaaaaaatca
ggaattgaatattttctaacctatgctgacaatttcgccatcggatatttccgcaaacaa
ggcttctcacaaaagattacaatgcccagagaacgatggtttgggtatattaaagattac
gatggaggcacgctcatggaatgctatatctcgccaaatattaattatctgagactcagc
gaaatgttaagcaggcaaaaggctgttgttatgcagtgcattgaagcgataaaaccacta
aaggtatacgatggtctcactgtgttcgctgaatcctcaaaggacagccaaaagaaaccc
agatgtacactcgttccatcagaaattccaggattaatagaagccggatggacagaagct
caagaaagccaacaaagtaaacaatctgatccaaatgcaccagctgacactgagccacag
aaaaaatcactcaaggcgtcaattctagaactcttgaataatctaaacaaacaacaaagc
gtttggccattcaggaaacccgttaaacaatcggaagctccagattactatgagattatt
acacaacccactgacatttcaacaatgaagagaaaggccaaacttggagaatacaaaaca
aaggaacagtttggagaagaactcaagagaatgtttgacaactgcaggctctacaacaca
tcacacaccatttattataaatatgcaaatgaattgcaggcctttatctggccacagtat
gaaaatattcaagaatga

DBGET integrated database retrieval system