KEGG   Babesia equi: BEWA_046540Help
Entry
BEWA_046540       CDS       T02820                                 

Definition
flavodoxin domain containing protein (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
beq  Babesia equi
Brite
Enzymes [BR:beq01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BEWA_046540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 716 aa AA seqDB search
MEVTTSAKETLRTPSVDLDLSKPSGQYPDGVGNMNIIVRISHIGDEEIKGWQRKEDNKVE
EDVQEAPSEEEEPEVPEVVKPTKPLPCRVYYGTQTGTSEKFARLLSSKLAEWDNISHKDP
ICLEDFEKEHFTDENVVIIFLISTHYDGLFTDDTIQFCKWLKTLERNRMSLSGLKFAMFG
FGSKEYDYYNKAAYDLQAKLLGLGAQEFSNLGLGDELAGFRFEFEKWVGVLYTSLSNLYE
TKPPKLKFDTKLKINPGDTWRSFAPLELRYTTYNMPSDFEAKATDVICKQQWQCRKATLL
LNENLTPKSEQDTHTLELTFDTPSTDRSFASNSSYAAKNRPKTACTFNTADTAFILYANP
KSTIDFFMEKLGVSESSGARISDEQMHKLITFVPRYGNVRDGSSFSAPFPVPCTVQDALE
FYCDLVSLPSAENLTKLCCFLRDPRECERLMKVITNKRLMKQMKEELCLSLEEFIRLFMP
NVTFHLFGFLQLIPKQIPRPYTISSKGGDTLRLTVKRIKRNLHSLKTFYNTNLKLEIFPE
GVNKSFLKARRIYEGICSNYLCDLKVDSKVNIFIRPSSFSTIQDFNKPMVLIANGAGIAP
FRGFWDSFTDDSEKLIMLGFRSRDDILYANELKELAQQSTINVKYAFSREKDKIYVQELV
RKNVEDITRILSTDGIITICGSRRMGNEVKLILANLIPDFDIEELKKESRFIEELW
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggaggttactacttccgctaaagaaactcttcgtaccccttctgttgatctagatctc
tctaaaccgtccggacaataccctgatggagttggtaatatgaatataatagtaagaatt
agtcacatcggtgatgaggaaataaaaggatggcagaggaaagaagataataaagtggag
gaagatgtgcaagaagcaccctccgaagaggaggaaccagaggtgccggaagtggtaaaa
ccgacaaaacctctaccttgtcgtgtatattatggaactcaaactggaacatctgagaaa
tttgccagacttttatcatctaaacttgcagagtgggacaatatatcacacaaggatccc
atttgcctagaggactttgagaaggaacactttacggatgaaaatgtggtcatcatcttc
ctcatttcaactcattacgacggtctatttactgatgacacaattcaattctgcaagtgg
ctaaagactttggagcgcaacaggatgtctttaagtggtcttaagtttgcaatgtttggc
tttggaagcaaagagtacgactactacaacaaggctgcctacgatttgcaagcaaagctt
ttgggtcttggagcgcaagagttttcaaatttgggccttggagatgaattggctggattc
agattcgagtttgaaaagtgggttggagttctctatacctcactctccaacctttacgag
acaaagcctccgaaactaaaatttgacacaaagctaaaaatcaatccaggggatacttgg
agatcatttgctcccctggaactccgttatacaacatataatatgccttcagactttgag
gcaaaggcaacagacgtgatctgcaaacaacagtggcaatgcagaaaggctacacttttg
ctcaatgaaaacctcactccaaagagtgagcaggacacacacacacttgagcttaccttt
gacactccttccacagacagatcgtttgcctcaaactcgtcatacgctgcaaagaatcga
ccaaagactgcatgcacattcaatacagcggatactgcgtttatactctatgcgaatcca
aaatcaaccattgacttttttatggaaaaactcggcgtttcagagtctagtggagctcgt
atcagtgatgagcaaatgcacaaactcatcacatttgttcctagatatggaaacgtcagg
gacggatcatcattctctgctccgttcccagtcccttgcacagttcaagatgccctggaa
ttttactgtgatttggtttctttaccaagtgctgagaatttgaccaagctttgctgtttt
ctcagggatccaagggagtgtgaaaggttgatgaaggtgattacgaataaacgtttgatg
aagcaaatgaaggaggagctttgtctaagtctggaggagtttattcgtttgttcatgcca
aacgtgacgtttcatctctttggatttctgcaactcattccaaagcagattccaagacca
tacacgatatcttccaaaggcggtgatactctccgtctgactgtaaagagaataaaaagg
aatctacactcgctcaagacattttataatacgaacttgaagctagagattttccctgaa
ggagttaacaagtcgtttttgaaagctaggagaatttacgagggtatctgtagcaactat
ctgtgcgatctcaaggttgattccaaggtcaatatctttatcagaccatcctcattctca
acaatccaagactttaataaaccaatggttcttatcgcaaacggagcaggaattgcgcca
tttaggggcttttgggattcattcaccgatgactctgaaaagctaataatgttagggttc
cggtcaagagatgatatcctctacgcaaacgagctaaaggaactcgcacaacaatccacc
attaacgtaaagtacgccttttccagagaaaaggacaagatttatgtccaagaactcgtt
cgtaaaaatgtggaagacataaccagaatactctccaccgatggcatcattacaatttgc
gggagtcgccgaatgggtaacgaggtcaagcttatcttggcaaatttaattccggatttt
gacattgaggagctcaagaaggaatcgcgattcattgaagaattgtggtaa

DBGET integrated database retrieval system