KEGG   Babesia equi: BEWA_049080Help
Entry
BEWA_049080       CDS       T02820                                 

Definition
choline/ethanolamine kinase, putative (EC:2.7.1.82)
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
beq  Babesia equi
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:beq00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BEWA_049080
Enzymes [BR:beq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     BEWA_049080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 376 aa AA seqDB search
MVSECLSPNTLMSNATAASSYMVKVDDSDELKDICIKYVPFWDKFGHGDIQVHKITSAMT
NRVYRVQVLEPRKDSLGAHKVLLRLVYPDELVSFDMECQNEVLELLSSHEFSPRLVAAFP
GGRIEQWLDGYILCTGSLQNISLLTSVAAILGKFHRTVSVVAKPSWSRKPMVDRIVERWL
PHVKVAVQKCGMDVDVDKLYRAFDVYKKVIAKHSETSQSFSNKVVFCHNDLHIKNIVATY
TGLRFIDFDYAGFNYAGYDVANFFADMPFCYVDQSPSFRVDESLELSRDLKVLFASVYLS
AATGSNVLPSDSETIDEFLKSVEIHTLGPVLLWSLWGILLAARPDVDSDFDYLSYSKVKF
SLFGKVLEESGLGYAL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggtctccgaatgtctgtctccaaatactctgatgagcaacgccaccgcggccagcagt
tacatggtcaaggtcgatgattctgacgagttgaaggacatttgtataaagtacgtcccc
ttctgggacaagtttggccacggggacatccaggtccacaagattacgagtgcaatgaca
aacagagtctacagggtccaggtgcttgaacccaggaaggactcgttgggggcacacaaa
gtgttgctgagactcgtatacccggatgaactcgtttccttcgatatggagtgtcaaaac
gaggtgcttgaactgctgagctcccacgagttctctcccagacttgtggcagcgtttcca
ggaggacgcatagagcagtggctggacgggtacatactctgtacgggctctttgcagaac
atctcgctactcacgtccgttgcagccatcctgggcaagtttcacaggacagttagtgta
gtcgccaagccgtcttggagcaggaaaccaatggttgataggatagttgagcggtggctc
ccgcatgtcaaagtggctgtacaaaagtgtggaatggacgtagacgtggacaaattatac
agggcgtttgatgtctacaagaaggttattgctaagcattctgagacgtcccagtccttc
tccaacaaggtcgtcttttgccacaatgacctgcatattaaaaacattgtagcgacttac
actgggctgcgcttcattgatttcgactatgccggcttcaattatgccgggtatgatgtc
gccaactttttcgcggatatgccattctgctacgtggaccagtctccgtcctttagagtt
gatgagtcgcttgagctttccagggacctcaaggttcttttcgccagtgtatatctctct
gcagccactggatcaaatgtgctaccatctgactctgagactatcgacgagtttctgaaa
tcagtcgagattcacactctgggacccgtgctcctctggtccctttggggcatcctcctg
gccgctagacccgatgtagacagtgatttcgactatctctcatacagcaaggttaagttt
agtctctttggaaaggtgctggaggaaagcggactgggatacgctctctag

DBGET integrated database retrieval system