KEGG   Bdellovibrio exovorus: A11Q_1589Help
Entry
A11Q_1589         CDS       T02492                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bex  Bdellovibrio exovorus
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bex00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A11Q_1589
  Amino acid metabolism
   00330 Arginine and proline metabolism
    A11Q_1589
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    A11Q_1589
Enzymes [BR:bex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     A11Q_1589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1614343..1615194
Genome map
AA seq 283 aa AA seqDB search
MASWSFLLHFLFCKIILIMAKKSKRIRWVVKAGSNMVCNGGPLLIKSWAQQVAQLRRDYN
IEVIWVSSGAIASAKSRIATNKIPKKNLKLNEKQALSAIGQPLVMDLYNMALQAESLRGA
QVLLTSDDLNHRGRRQNLKNTLQTLLKWDIIPVLNENDTVATEEIQFGDNDSLSARVAIH
MNADRLVILTDVDGLFDSDPTKNPQARLVPSLERVATKDLTQPGLKGKSQHGTGGMYSKL
LASRLATQKGIESFLVKGDLPSVLLQLAKGVSVGTHIKAKKSK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtggagtttcttgcttcacttcctattctgtaagatcattttaatcatggcg
aaaaaatcaaagcgtattcgttgggttgttaaagcaggtagcaatatggtctgtaatggt
ggacctcttcttattaaatcatgggctcaacaagtggcccaattacgacgggattacaat
atcgaagttatatgggtttcgtcgggagctatcgcctctgcgaaaagtcgtatcgctaca
aataaaattcctaaaaaaaatctgaagctcaatgaaaaacaagctctttccgccatcgga
caaccgctggtgatggacctttacaacatggctttacaagctgagtctttgcgtggagca
caggtgcttttaacctctgatgatttgaatcatcgtggacgtcgtcaaaatttaaaaaac
actctacaaactcttttaaagtgggacattattcctgttcttaacgaaaatgatactgtt
gccacggaagaaatccaatttggtgataatgactcgttatccgcacgtgtggcgattcac
atgaatgctgatcgcttagttattctaacggatgtggacgggctattcgattcagatcca
actaaaaatcctcaggcaagattggtcccatcgctggaacgagtggcgacgaaggatctg
actcaacccggccttaagggaaagagtcaacatggcacaggtggaatgtactcgaagcta
ttggcttcacgtctagccacgcaaaaaggtatcgagagttttctggtcaagggcgatttg
ccttccgttcttttacaattagccaaaggagtctcggttggaactcatatcaaagctaaa
aaaagtaaataa

DBGET integrated database retrieval system