KEGG   Bdellovibrio exovorus: A11Q_1589Help
Entry
A11Q_1589         CDS       T02492                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bex  Bdellovibrio exovorus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bex01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bex00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1614343..1615194
Genome map
AA seq 283 aa AA seqDB search
MASWSFLLHFLFCKIILIMAKKSKRIRWVVKAGSNMVCNGGPLLIKSWAQQVAQLRRDYN
IEVIWVSSGAIASAKSRIATNKIPKKNLKLNEKQALSAIGQPLVMDLYNMALQAESLRGA
QVLLTSDDLNHRGRRQNLKNTLQTLLKWDIIPVLNENDTVATEEIQFGDNDSLSARVAIH
MNADRLVILTDVDGLFDSDPTKNPQARLVPSLERVATKDLTQPGLKGKSQHGTGGMYSKL
LASRLATQKGIESFLVKGDLPSVLLQLAKGVSVGTHIKAKKSK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtggagtttcttgcttcacttcctattctgtaagatcattttaatcatggcg
aaaaaatcaaagcgtattcgttgggttgttaaagcaggtagcaatatggtctgtaatggt
ggacctcttcttattaaatcatgggctcaacaagtggcccaattacgacgggattacaat
atcgaagttatatgggtttcgtcgggagctatcgcctctgcgaaaagtcgtatcgctaca
aataaaattcctaaaaaaaatctgaagctcaatgaaaaacaagctctttccgccatcgga
caaccgctggtgatggacctttacaacatggctttacaagctgagtctttgcgtggagca
caggtgcttttaacctctgatgatttgaatcatcgtggacgtcgtcaaaatttaaaaaac
actctacaaactcttttaaagtgggacattattcctgttcttaacgaaaatgatactgtt
gccacggaagaaatccaatttggtgataatgactcgttatccgcacgtgtggcgattcac
atgaatgctgatcgcttagttattctaacggatgtggacgggctattcgattcagatcca
actaaaaatcctcaggcaagattggtcccatcgctggaacgagtggcgacgaaggatctg
actcaacccggccttaagggaaagagtcaacatggcacaggtggaatgtactcgaagcta
ttggcttcacgtctagccacgcaaaaaggtatcgagagttttctggtcaagggcgatttg
ccttccgttcttttacaattagccaaaggagtctcggttggaactcatatcaaagctaaa
aaaagtaaataa

DBGET integrated database retrieval system